Reaction Details |
| Report a problem with these data |
Target | Apoptosis regulator Bcl-2 |
---|
Ligand | BDBM177874 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Fluorescence Polarisation Assay |
---|
pH | 7.4±n/a |
---|
IC50 | 22±n/a nM |
---|
Comments | extracted |
---|
Citation | Le Diguarher, T; Casara, P; Starck, J; Henlin, J; Davidson, JE; Murray, JB; Graham, CJ; Chen, I; Geneste, O; Hickman, J; Depil, S; Le Tiran, A; Nyerges, M; De Nanteuil, G Indolizine compounds, a process for their preparation and pharmaceutical compositions containing them US Patent US9120791 Publication Date 9/1/2015 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Apoptosis regulator Bcl-2 |
---|
Name: | Apoptosis regulator Bcl-2 |
Synonyms: | BCL2_MOUSE | Bcl-2 | Bcl2 |
Type: | Protein |
Mol. Mass.: | 26409.44 |
Organism: | Mus musculus (Mouse) |
Description: | P10417 |
Residue: | 236 |
Sequence: | MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPA
VHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP
FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNR
HLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
BDBM177874 |
---|
n/a |
---|
Name | BDBM177874 |
Synonyms: | US9120791, Example 100 |
Type | Small organic molecule |
Emp. Form. | C42H41FN4O5 |
Mol. Mass. | 700.7971 |
SMILES | OC1CCn2c(C1)c(cc2-c1cc(F)ccc1C(=O)N1Cc2ccccc2C[C@H]1CN1CCOCC1)C(=O)N(c1ccccc1)c1ccc(O)cc1 |
Structure |
|