Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 8
LigandBDBM19149
Substrate/Competitorn/a
Meas. Tech.In-vitro HDAC Enzymatic Endpoint Assay
pH7.4±n/a
Temperature298.15±n/a K
IC50 1.02e+3± 187 nM
Commentsextracted
Citation Wagner FFLundh MKaya TMcCarren PZhang YLChattopadhyay SGale JPGalbo TFisher SLMeier BCVetere ARichardson SMorgan NGChristensen DPGilbert TJHooker JMLeroy MWalpita DMandrup-Poulsen TWagner BKHolson EB An Isochemogenic Set of Inhibitors To Define the Therapeutic Potential of Histone Deacetylases in -Cell Protection. ACS Chem Biol 11:363-74 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 8
Name:Histone deacetylase 8
Synonyms:HD8 | Histone deacetylase 8 (HDAC-8) | Human HDAC8
Type:Enzyme
Mol. Mass.:41749.60
Organism:Homo sapiens (Human)
Description:Q9BY41
Residue:377
Sequence:
MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPK
VASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATI
TAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLH
HGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKY
YQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLI
LGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPH
RIQQILNYIKGNLKHVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM19149
n/a
NameBDBM19149
Synonyms:CHEMBL98 | N-hydroxy-N'-phenyloctanediamide | SAHA | US10188756, Compound SAHA | US9115116, SAHA | US9353061, SAHA | US9428447, SAHA | US9695181, Vorinostat | Vorinostat | Zolinza | cid_5311 | suberoylanilide hydroxamic acid
TypeSmall organic molecule
Emp. Form.C14H20N2O3
Mol. Mass.264.3202
SMILESONC(=O)CCCCCCC(=O)Nc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: