Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetN-acetyl-beta-D-glucosaminidase (O-GlcNAcase)
LigandBDBM179374
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
pH7±n/a
Temperature298.15±n/a K
Ki 0.14±n/a nM
Commentsextracted
Citation Selnick HGLiu KMcEachern EJZhou YZhu Y Selective glycosidase inhibitors and uses thereof US Patent  US9126957 Publication Date 9/8/2015
More Info.:Get all data from this article,  Assay Method
 
N-acetyl-beta-D-glucosaminidase (O-GlcNAcase)
Name:N-acetyl-beta-D-glucosaminidase (O-GlcNAcase)
Synonyms:2-acetamido-2-deoxy-β-D-glucopyranosidase (O-GlcNAcase) | Beta-N-acetylhexosaminidase | Beta-hexosaminidase (O-GlcNAcase) | Bifunctional protein NCOAT | O-glycoprotein 2-acetamido-2-deoxy-β-D-glucopyranosidase (O-GlcNAcase) | Protein O-GlcNAcase
Type:Enzyme
Mol. Mass.:102874.67
Organism:Homo sapiens (Human)
Description:O60502
Residue:916
Sequence:
MVQKESQATLEERESELSSNPAASAGASLEPPAAPAPGEDNPAGAGGAAVAGAAGGARRF
LCGVVEGFYGRPWVMEQRKELFRRLQKWELNTYLYAPKDDYKHRMFWREMYSVEEAEQLM
TLISAAREYEIEFIYAISPGLDITFSNPKEVSTLKRKLDQVSQFGCRSFALLFDDIDHNM
CAADKEVFSSFAHAQVSITNEIYQYLGEPETFLFCPTEYCGTFCYPNVSQSPYLRTVGEK
LLPGIEVLWTGPKVVSKEIPVESIEEVSKIIKRAPVIWDNIHANDYDQKRLFLGPYKGRS
TELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVMTDSEDSTVSIQIKLE
NEGSDEDIETDVLYSPQMALKLALTEWLQEFGVPHQYSSRQVAHSGAKASVVDGTPLVAA
PSLNATTVVTTVYQEPIMSQGAALSGEPTTLTKEEEKKQPDEEPMDMVVEKQEETDHKND
NQILSEIVEAKMAEELKPMDTDKESIAESKSPEMSMQEDCISDIAPMQTDEQTNKEQFVP
GPNEKPLYTAEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKD
SEKIEEWRSRAAKFEEMCGLVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQW
LGCRSHSSAQFLIGDQEPWAFRGGLAGEFQRLLPIDGANDLFFQPPPLTPTSKVYTIRPY
FPKDEASVYKICREMYDDGVGLPFQSQPDLIGDKLVGGLLSLSLDYCFVLEDEDGICGYA
LGTVDVTPFIKKCKISWIPFMQEKYTKPNGDKELSEAEKIMLSFHEEQEVLPETFLANFP
SLIKMDIHKKVTDPSVAKSMMACLLSSLKANGSRGAFCEVRPDDKRILEFYSKLGCFEIA
KMEGFPKDVVILGRSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM179374
n/a
NameBDBM179374
Synonyms:US9126957, 10
TypeSmall organic molecule
Emp. Form.C11H20N2O3S
Mol. Mass.260.353
SMILESC[C@@H](O)[C@@H]1C[C@H]2SC(=N[C@H]2[C@H](O)[C@H]1O)N(C)C |c:7|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: