| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A1 |
|---|
| Ligand | BDBM191778 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Luciferase Assay |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 310.15±n/a K |
|---|
| EC50 | 0.06±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Vakalopoulos, A; Meibom, D; Nell, P; Sussmeier, F; Albrecht-Kupper, B; Zimmermann, K; Keldenich, J; Schneider, D; Krenz, U Substituted dicyanopyridines and use thereof US Patent US9187428 Publication Date 11/17/2015 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A1 |
|---|
| Name: | Adenosine receptor A1 |
|---|
| Synonyms: | A1 adenosine receptor (hA1) | A1AR | AA1R_HUMAN | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT) |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 36520.92 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30542 |
|---|
| Residue: | 326 |
|---|
| Sequence: | MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
|
|
|
|---|
| BDBM191778 |
|---|
| n/a |
|---|
| Name | BDBM191778 |
|---|
| Synonyms: | US9187428, 6 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H18N6O3S |
|---|
| Mol. Mass. | 458.492 |
|---|
| SMILES | CNC(=O)c1cc(CSc2nc(N)c(C#N)c(-c3ccc4OCCOc4c3)c2C#N)ccn1 |
|---|
| Structure | 
|
|---|
Search and Browse
