| Reaction Details |
|---|
 | Report a problem with these data |
| Target | ATP-sensitive inward rectifier potassium channel 1 |
|---|
| Ligand | BDBM195026 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Electrophysiology Assay |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 310.15±n/a K |
|---|
| IC50 | 20±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Ding, F; Dong, S; Frie, J; Gu, X; Jiang, J; Pasternak, A; Tang, H; Wu, Z; Yu, Y; Suzuki, T Inhibitors of the renal outer medullary potassium channel US Patent US9206198 Publication Date 12/8/2015 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| ATP-sensitive inward rectifier potassium channel 1 |
|---|
| Name: | ATP-sensitive inward rectifier potassium channel 1 |
|---|
| Synonyms: | ATP-regulated potassium channel ROM-K | ATP-regulated potassium channel ROMK | ATP-sensitive inward rectifier potassium channel 1 | Egl nine homolog 1 | KCNJ1 | KCNJ1_HUMAN | Potassium channel (ATP modulatory) | Potassium inwardly-rectifying channel, subfamily J, member 1 | ROMK1 | Renal Outer Medullary Potassium (ROMK1) | The Renal Outer Medullary Potassium (ROMK) |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 44809.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_223460826 |
|---|
| Residue: | 391 |
|---|
| Sequence: | MNASSRNVFDTLIRVLTESMFKHLRKWVVTRFFGHSRQRARLVSKDGRCNIEFGNVEAQS
RFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWYAVAYIHKDLPEFHPSANHTP
CVENINGLTSAFLFSLETQVTIGYGFRCVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGE
TIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLY
NEKDVRARMKRGYDNPNFILSEVNETDDTKM
|
|
|
|---|
| BDBM195026 |
|---|
| n/a |
|---|
| Name | BDBM195026 |
|---|
| Synonyms: | US9206198, 30 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H30N2O6 |
|---|
| Mol. Mass. | 454.5155 |
|---|
| SMILES | CC1CC2(CCN(C[C@@H](O)c3ccc4C(=O)OCc4c3C)CC2)C(=O)N1C1=C(C)C(=O)OC1 |r,c:30| |
|---|
| Structure | 
|
|---|
Search and Browse
