Reaction Details |
| Report a problem with these data |
Target | Lysine-specific demethylase 4C [1-350] |
---|
Ligand | BDBM195610 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | KDM4C Enzymatic Screening Assay |
---|
pH | 7.5±n/a |
---|
IC50 | 6.2e+2±n/a nM |
---|
Comments | extracted |
---|
Citation | Vinogradova, M; Gehling, VS; Gustafson, A; Arora, S; Tindell, CA; Wilson, C; Williamson, KE; Guler, GD; Gangurde, P; Manieri, W; Busby, J; Flynn, EM; Lan, F; Kim, HJ; Odate, S; Cochran, AG; Liu, Y; Wongchenko, M; Yang, Y; Cheung, TK; Maile, TM; Lau, T; Costa, M; Hegde, GV; Jackson, E; Pitti, R; Arnott, D; Bailey, C; Bellon, S; Cummings, RT; Albrecht, BK; Harmange, JC; Kiefer, JR; Trojer, P; Classon, M An inhibitor of KDM5 demethylases reduces survival of drug-tolerant cancer cells. Nat Chem Biol12:531-8 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Lysine-specific demethylase 4C [1-350] |
---|
Name: | Lysine-specific demethylase 4C [1-350] |
Synonyms: | GASC1 | JHDM3C | JMJD2C | KDM4C | KDM4C_HUMAN | KIAA0780 | Lysine-specific demethylase 4C (KDM4C) |
Type: | Protein |
Mol. Mass.: | 40626.08 |
Organism: | Homo sapiens (Human) |
Description: | Q9H3R0; His-tagged recombinant KDM4C (1-350) overexpressed in E. coli(DE3) |
Residue: | 350 |
Sequence: | MEVAEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQC
YDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSGKYCTPRYLDYEDLE
RKYWKNLTFVAPIYGADINGSIYDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYF
GMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAQGFFPSSSQGCDAFL
RHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATVRWID
YGKVAKLCTCRKDMVKISMDIFVRKFQPDRYQLWKQGKDIYTIDHTKPTP
|
|
|
BDBM195610 |
---|
n/a |
---|
Name | BDBM195610 |
Synonyms: | KDM inhibitor, 3 |
Type | Small organic molecule |
Emp. Form. | C10H10N4O |
Mol. Mass. | 202.2126 |
SMILES | CCc1c(C)[nH]c2c(cnn2c1=O)C#N |
Structure |
|