Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein phosphatase 2A regulatory subunit B'
LigandBDBM199180
Substrate/Competitorn/a
Meas. Tech.PTP pNPP Assay
pH7±n/a
Temperature298.15±n/a K
Ki>1000±0.0 nM
Commentsextracted
Citation Zhang ZZhang S Inhibitors of protein tyrosine phosphatases US Patent  US9217012 Publication Date 12/22/2015
More Info.:Get all data from this article,  Assay Method
 
Protein phosphatase 2A regulatory subunit B'
Name:Protein phosphatase 2A regulatory subunit B'
Synonyms:5.2.1.8 | PP2A, subunit B'''', PR53 isoform | PP2A, subunit B'', PR53 isoform | PPP2R4 | PTPA | Phosphotyrosyl phosphatase activator | Protein phosphatase 2A regulatory subunit B | Serine/threonine-protein phosphatase 2A activator | Serine/threonine-protein phosphatase 2A regulatory subunit 4 | Serine/threonine-protein phosphatase 2A regulatory subunit B''
Type:n/a
Mol. Mass.:40662.53
Organism:Homo sapiens (Human)
Description:Q15257
Residue:358
Sequence:
MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVK
GKKLTFEYRVSEMWNEVHEEKEQAAKQSVSCDECIPLPRAGHCAPSEAIEKLVALLNTLD
RWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGN
STRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAG
SQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKT
GPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM199180
n/a
NameBDBM199180
Synonyms:US9217012, 10
TypeSmall organic molecule
Emp. Form.C46H62F2N5O9P
Mol. Mass.897.9831
SMILESCCc1ccc(cc1)C(=O)NCCCCC(NC(=O)C(Cc1ccc(cc1)C(F)(F)P(O)(O)=O)NC(=O)C(Cc1ccccc1)NC(=O)COC1CC(C)CCC1C(C)C)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: