Reaction Details |
| Report a problem with these data |
Target | Low molecular weight phosphotyrosine protein phosphatase |
---|
Ligand | BDBM199180 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | PTP pNPP Assay |
---|
pH | 7±n/a |
---|
Temperature | 298.15±n/a K |
---|
Ki | >1000±0.0 nM |
---|
Comments | extracted |
---|
Citation | Zhang, Z; Zhang, S Inhibitors of protein tyrosine phosphatases US Patent US9217012 Publication Date 12/22/2015 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Low molecular weight phosphotyrosine protein phosphatase |
---|
Name: | Low molecular weight phosphotyrosine protein phosphatase |
Synonyms: | 3.1.3.2 | 3.1.3.48 | ACP1 | Adipocyte acid phosphatase | LMW-PTP | LMW-PTPase | LMWPTP | Low molecular weight cytosolic acid phosphatase | PPAC_HUMAN | Red cell acid phosphatase 1 | low molecular weight phosphotyrosine protein phosphatase isoform c |
Type: | n/a |
Mol. Mass.: | 18042.81 |
Organism: | Homo sapiens (Human) |
Description: | P24666 |
Residue: | 158 |
Sequence: | MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRG
QSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
|
|
|
BDBM199180 |
---|
n/a |
---|
Name | BDBM199180 |
Synonyms: | US9217012, 10 |
Type | Small organic molecule |
Emp. Form. | C46H62F2N5O9P |
Mol. Mass. | 897.9831 |
SMILES | CCc1ccc(cc1)C(=O)NCCCCC(NC(=O)C(Cc1ccc(cc1)C(F)(F)P(O)(O)=O)NC(=O)C(Cc1ccccc1)NC(=O)COC1CC(C)CCC1C(C)C)C(N)=O |
Structure |
|