| Reaction Details |
|---|
 | Report a problem with these data |
| Target | D-amino-acid oxidase |
|---|
| Ligand | BDBM50431086 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | In Vitro DAAO Enzyme Assay |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 10±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Farnaby, W; Fieldhouse, C; Hazel, K; Kerr, C; Kinsella, N; Livermore, D; Merchant, K; Miller, D Pyridazinone compounds and their use as DAAO inhibitors US Patent US9290456 Publication Date 3/22/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| D-amino-acid oxidase |
|---|
| Name: | D-amino-acid oxidase |
|---|
| Synonyms: | D-amino-acid oxidase (DAAO) | DAAO | DAMOX | DAO | OXDA_HUMAN |
|---|
| Type: | Homodimer |
|---|
| Mol. Mass.: | 39476.06 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P14920 |
|---|
| Residue: | 347 |
|---|
| Sequence: | MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPN
NPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPR
ELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVN
CTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGG
IFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLRTGP
SNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSRMPPSHL
|
|
|
|---|
| BDBM50431086 |
|---|
| n/a |
|---|
| Name | BDBM50431086 |
|---|
| Synonyms: | CHEMBL2338800 | US10202399, Example 212 | US10463663, Example 2 | US11129828, Example 2 | US9212147, 212 | US9290456, 2 | US9931340, Example 2 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H11FN2O2 |
|---|
| Mol. Mass. | 234.2263 |
|---|
| SMILES | Oc1cc(CCc2ccc(F)cc2)n[nH]c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
