Reaction Details |
| Report a problem with these data |
Target | Vitamin K epoxide reductase complex subunit 1-like protein 1 |
---|
Ligand | BDBM50343352 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | VKOR Activity Assay |
---|
pH | 7.4±n/a |
---|
Temperature | 310.15±n/a K |
---|
Ki | 5.20e+4± 3.0e+3 nM |
---|
Comments | extracted |
---|
Citation | Hammed, A; Matagrin, B; Spohn, G; Prouillac, C; Benoit, E; Lattard, V VKORC1L1, an enzyme rescuing the vitamin K 2,3-epoxide reductase activity in some extrahepatic tissues during anticoagulation therapy. J Biol Chem288:28733-42 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Vitamin K epoxide reductase complex subunit 1-like protein 1 |
---|
Name: | Vitamin K epoxide reductase complex subunit 1-like protein 1 |
Synonyms: | VKORC1-like 1 (hVKORC1L1) | VKORC1L1 | VKORL_HUMAN |
Type: | Enzyme |
Mol. Mass.: | 19843.50 |
Organism: | Homo sapiens (Human) |
Description: | Q8N0U8 |
Residue: | 176 |
Sequence: | MAAPVLLRVSVPRWERVARYAVCAAGILLSIYAYHVEREKERDPEHRALCDLGPWVKCSA
ALASRWGRGFGLLGSIFGKDGVLNQPNSVFGLIFYILQLLLGMTASAVAALILMTSSIMS
VVGSLYLAYILYFVLKEFCIICIVTYVLNFLLLIINYKRLVYLNEAWKRQLQPKQD
|
|
|
BDBM50343352 |
---|
n/a |
---|
Name | BDBM50343352 |
Synonyms: | 2-hydroxy-3-(3-oxo-1-phenylbutyl)-4H-chromen-4-one | 4-(4-hydroxy-2-oxo-2H-3-chromenyl)-4-phenyl-2-butanone | 4-Hydroxy-3-(3-oxo-1-phenyl-butyl)-chromen-2-one | 4-hydroxy-3-(3-oxo-1-phenylbutyl)-2H-chromen-2-one | CHEMBL1464 | Coumadin | Jantoven | Warfarin4-Hydroxy-3-(3-oxo-1-phenyl-butyl)-chromen-2-one | wafarin | warfarin | warfarine |
Type | Small organic molecule |
Emp. Form. | C19H16O4 |
Mol. Mass. | 308.3279 |
SMILES | CC(=O)CC(c1ccccc1)c1c(O)c2ccccc2oc1=O |
Structure |
|