| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Vitamin K epoxide reductase complex subunit 1-like protein 1 |
|---|
| Ligand | BDBM50343352 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | VKOR Activity Assay |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 310.15±n/a K |
|---|
| Ki | 3.26e+4± 1.9e+3 nM |
|---|
| Comments | extracted |
|---|
| Citation |  Hammed, A; Matagrin, B; Spohn, G; Prouillac, C; Benoit, E; Lattard, V VKORC1L1, an enzyme rescuing the vitamin K 2,3-epoxide reductase activity in some extrahepatic tissues during anticoagulation therapy. J Biol Chem288:28733-42 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Vitamin K epoxide reductase complex subunit 1-like protein 1 |
|---|
| Name: | Vitamin K epoxide reductase complex subunit 1-like protein 1 |
|---|
| Synonyms: | VKORC1-like 1 (rVKORC1L1) | VKORL_RAT | Vkorc1l1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 19785.33 |
|---|
| Organism: | Rattus norvegicus (Rat) |
|---|
| Description: | Q6TEK3 |
|---|
| Residue: | 176 |
|---|
| Sequence: | MAAPVLLRVSVPRWERVARYAVCAAGILLSIYAYHVEREKERDPEHRALCDLGPWVKCSA
ALASRWGRGFGLLGSIFGKDGVLNQPNSVFGLIFYILQLLLGMTASAVAALVLMTSSIVS
VVGSLYLAYILYFVLKEFCIICVTTYVLNFLLLIINYKRLVYLNEAWKRQLQPKED
|
|
|
|---|
| BDBM50343352 |
|---|
| n/a |
|---|
| Name | BDBM50343352 |
|---|
| Synonyms: | 2-hydroxy-3-(3-oxo-1-phenylbutyl)-4H-chromen-4-one | 4-(4-hydroxy-2-oxo-2H-3-chromenyl)-4-phenyl-2-butanone | 4-Hydroxy-3-(3-oxo-1-phenyl-butyl)-chromen-2-one | 4-hydroxy-3-(3-oxo-1-phenylbutyl)-2H-chromen-2-one | CHEMBL1464 | Coumadin | Jantoven | Warfarin4-Hydroxy-3-(3-oxo-1-phenyl-butyl)-chromen-2-one | wafarin | warfarin | warfarine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H16O4 |
|---|
| Mol. Mass. | 308.3279 |
|---|
| SMILES | CC(=O)CC(c1ccccc1)c1c(O)c2ccccc2oc1=O |
|---|
| Structure | 
|
|---|
Search and Browse
