| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tyrosine-protein phosphatase non-receptor type 1 |
|---|
| Ligand | BDBM7458 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | PTP1B Inhibitory Assay |
|---|
| pH | 6±n/a |
|---|
| IC50 | 100000±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Nguyen, DH; Seo, UM; Zhao, BT; Le, DD; Seong, SH; Choi, JS; Min, BS; Woo, MH Ellagitannin and flavonoid constituents from Agrimonia pilosa Ledeb. with their protein tyrosine phosphatase and acetylcholinesterase inhibitory activities Bioorg Chem72:293-300 (2017) |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tyrosine-protein phosphatase non-receptor type 1 |
|---|
| Name: | Tyrosine-protein phosphatase non-receptor type 1 |
|---|
| Synonyms: | PTN1_HUMAN | PTP1B | PTPN1 | Protein tyrosine phosphatase 1B (PTP1B) | Protein tyrosine phosphatase-1B (PTP1B) | Protein-tyrosine phosphatase 1B | Protein-tyrosine phosphatase 1B (PTP1B) | Tyrosine-protein phosphatase non-receptor type 1 | Tyrosine-protein phosphatase non-receptor type 1 (PTP1B) |
|---|
| Type: | Protein phosphatase |
|---|
| Mol. Mass.: | 49963.76 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human recombinant GST-fusion PTP1B (1-435). |
|---|
| Residue: | 435 |
|---|
| Sequence: | MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLE
PPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYG
IESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLT
AGAYLCYRFLFNSNT
|
|
|
|---|
| BDBM7458 |
|---|
| n/a |
|---|
| Name | BDBM7458 |
|---|
| Synonyms: | 5,7-dihydroxy-2-(4-hydroxyphenyl)-4H-chromen-4-one | 5,7-dihydroxy-2-(4-hydroxyphenyl)-chromen-4-one | Apigenin | Apigenin (2) | Apigenin (3) | Apigenin (7) | Apigenin, 13 | CHEMBL28 | Naringenin, 18 | US10278929, Apigenin | US11337935, Compound Apigenin | acs.jmedchem.1c00409_ST.789 | cid_5280443 | jm5b01461, Compound 90 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H10O5 |
|---|
| Mol. Mass. | 270.2369 |
|---|
| SMILES | Oc1ccc(cc1)-c1cc(=O)c2c(O)cc(O)cc2o1 |
|---|
| Structure | 
|
|---|
Search and Browse
