| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bromodomain-containing protein 4 [44-166,I246A] |
|---|
| Ligand | BDBM227644 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | TR-FRET Competition Assay |
|---|
| pH | 7.5±0 |
|---|
| Temperature | 277.15±0 K |
|---|
| Kd | 1.71e+4± 9.8e+3 nM |
|---|
| Citation |  Jung, M; Philpott, M; Müller, S; Schulze, J; Badock, V; Eberspächer, U; Moosmayer, D; Bader, B; Schmees, N; Fernández-Montalván, A; Haendler, B Affinity map of bromodomain protein 4 (BRD4) interactions with the histone H4 tail and the small molecule inhibitor JQ1. J Biol Chem289:9304-19 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bromodomain-containing protein 4 [44-166,I246A] |
|---|
| Name: | Bromodomain-containing protein 4 [44-166,I246A] |
|---|
| Synonyms: | BRD4 | BRD4_HUMAN | Bromodomain protein 4 bromodomain 1 (BRD4 BD1 I146A) | HUNK1 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 14568.20 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human BRD4 BD1 (44-166 aa) I146A mutant |
|---|
| Residue: | 123 |
|---|
| Sequence: | NPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKT
PMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDAVLMAEALEKLFLQKINE
LPT
|
|
|
|---|
| BDBM227644 |
|---|
| n/a |
|---|
| Name | BDBM227644 |
|---|
| Synonyms: | Histone H4 (1-25) | MSGRGKGGKGLGKGGAKRHRKVLRD |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C108H196N44O29S |
|---|
| Mol. Mass. | 2607.054 |
|---|
| SMILES | CSCC[C@H](N)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)NCC(=O)NCC(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)NCC(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
