Reaction Details |
| Report a problem with these data |
Target | Cannabinoid receptor 2 |
---|
Ligand | BDBM85804 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Functional Assay |
---|
Ki | 9.8±0.9 nM |
---|
Citation | Prather, PL; Prisinzano, TE; Fantegrossi, WE; Brents, LK; Moran, J; Radominska-Pandya, A; Vasiljevik, T Use of the aminoalkylindole JWH-073-M4 and related compounds as neutral CB1 receptor antagonists for the treatment of alcoholism, drug abuse, obesity, and obesity-related diseases US Patent US9416103 Publication Date 8/16/2016 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cannabinoid receptor 2 |
---|
Name: | Cannabinoid receptor 2 |
Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 39690.94 |
Organism: | Homo sapiens (Human) |
Description: | P34972 |
Residue: | 360 |
Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
BDBM85804 |
---|
n/a |
---|
Name | BDBM85804 |
Synonyms: | 1-Naphthyl(1-butyl-1H-indole-3-yl)methanone | JWH-073 | US9416103, JWH-073 |
Type | Small organic molecule |
Emp. Form. | C23H21NO |
Mol. Mass. | 327.4189 |
SMILES | CCCCn1cc(C(=O)c2cccc3ccccc23)c2ccccc12 |
Structure |
|