| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Glutathione peroxidase 1 |
|---|
| Ligand | BDBM237182 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Glutathione Peroxidase Activity Assay |
|---|
| pH | 7±n/a |
|---|
| Ki | 121200±n/a nM |
|---|
| IC50 | 186300±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Ekinci, D; Cankaya, M; Gül, Ä°; Coban, TA Susceptibility of cord blood antioxidant enzymes glutathione reductase, glutathione peroxidase and glutathione S-transferase to different antibiotics: in vitro approach. J Enzyme Inhib Med Chem28:824-9 (2013) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Glutathione peroxidase 1 |
|---|
| Name: | Glutathione peroxidase 1 |
|---|
| Synonyms: | Cellular glutathione peroxidase | GPX1 | GPX1_HUMAN | GPx-1 | GSHPx-1 | Glutathione peroxidase 1 (GPx) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21937.89 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P07203 |
|---|
| Residue: | 202 |
|---|
| Sequence: | MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLGTTVRDYTQMNE
LQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAG
AHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSR
RFQTIDIEPDIEALLSQGPSCA
|
|
|
|---|
| BDBM237182 |
|---|
| n/a |
|---|
| Name | BDBM237182 |
|---|
| Synonyms: | Ceftizoxime |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H13N5O5S2 |
|---|
| Mol. Mass. | 383.403 |
|---|
| SMILES | CO\N=C(/C(=O)N[C@H]1[C@H]2SCC=C(N2C1=O)C(O)=O)c1csc(N)n1 |c:11| |
|---|
| Structure | 
|
|---|
Search and Browse
