Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin-1
LigandBDBM294039
Substrate/Competitorn/a
Meas. Tech.Human Trypsin Assay
pH8.2±n/a
Ki>20000±n/a nM
Commentsextracted
Citation Chen SDing ZGong GYan XHuang WGuo FDuan BGao RZhou PLu XDong G Preparation method for benzoxazoleoxazine ketone compound and intermediate and crystal form thereof US Patent  US10106557 Publication Date 10/23/2018
More Info.:Get all data from this article,  Assay Method
 
Trypsin-1
Name:Trypsin-1
Synonyms:Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | Trypsin | Trypsin I
Type:Enzyme
Mol. Mass.:26557.80
Organism:Homo sapiens (Human)
Description:P07477
Residue:247
Sequence:
MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM294039
n/a
NameBDBM294039
Synonyms:Process 1 | US10106557, Compound 1
TypeSmall organic molecule
Emp. Form.C18H18N2O5
Mol. Mass.342.3459
SMILESOc1cc(ccc1NC(=O)OCc1ccccc1)N1CCOCC1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: