| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine protease 1 |
|---|
| Ligand | BDBM294043 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Human Trypsin Assay |
|---|
| pH | 8.2±n/a |
|---|
| Ki | >20000±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Chen, S; Ding, Z; Gong, G; Yan, X; Huang, W; Guo, F; Duan, B; Gao, R; Zhou, P; Lu, X; Dong, G Preparation method for benzoxazoleoxazine ketone compound and intermediate and crystal form thereof US Patent US10106557 Publication Date 10/23/2018 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine protease 1 |
|---|
| Name: | Serine protease 1 |
|---|
| Synonyms: | Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | TRP1 | TRY1 | TRY1_HUMAN | TRYP1 | Thrombin & trypsin | Trypsin | Trypsin I | Trypsin-1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 26557.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P07477 |
|---|
| Residue: | 247 |
|---|
| Sequence: | MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
|
|
|
|---|
| BDBM294043 |
|---|
| n/a |
|---|
| Name | BDBM294043 |
|---|
| Synonyms: | US10106557, Compound 30 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H24ClN3O5S |
|---|
| Mol. Mass. | 477.961 |
|---|
| SMILES | COC[C@H]1CCCN1c1ccc2N3[C@@H](COc2c1)[C@H](CNC(=O)c1ccc(Cl)s1)OC3=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
