| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Substance-P receptor |
|---|
| Ligand | BDBM50081363 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Binding Assay |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| Ki | >10000±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Hoveyda, HR; Dutheuil, G; Fraser, GL; Roy, M; El Bousmaqui, M; Batt, F Chiral N-acyl-5,6,7(8-substituted)-tetrahydro-[1,2,4]triazolo[4,3-a]pyrazines as selective NK-3 receptor antagonists, pharmaceutical composition, methods for use in NK-3 receptor mediated disorders and chiral synthesis thereof US Patent US9475814 Publication Date 10/25/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Substance-P receptor |
|---|
| Name: | Substance-P receptor |
|---|
| Synonyms: | NK-1 receptor | NK-1R | NK1 Receptor | NK1R | NK1R_HUMAN | Neurokinin 1 receptor | Neurokinin-1 (NK-1) | Neuromedin-1 receptor (NK-1R) | SPR | TAC1R | TACR1 | Tachykinin receptor 1 | Tachykinin receptor 1 (NK1) | tachykinin |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 46254.43 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P25103 |
|---|
| Residue: | 407 |
|---|
| Sequence: | MDNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAH
KRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASI
YSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVC
MIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV
SAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMY
NPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTIST
VVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS
|
|
|
|---|
| BDBM50081363 |
|---|
| n/a |
|---|
| Name | BDBM50081363 |
|---|
| Synonyms: | CHEMBL3422012 | US10065961, Compound 3 | US10683295, Compound 3 | US10941151, Compound 3 | US9475814, 3 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H17N5OS2 |
|---|
| Mol. Mass. | 407.512 |
|---|
| SMILES | Cc1nc(cs1)-c1nnc2CN(CCn12)C(=O)c1ccc(cc1)-c1cccs1 |
|---|
| Structure | 
|
|---|
Search and Browse
