| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Substance-K receptor |
|---|
| Ligand | BDBM50081197 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Binding Assay |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| Ki | >10000±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Hoveyda, HR; Dutheuil, G; Fraser, GL; Roy, M; El Bousmaqui, M; Batt, F Chiral N-acyl-5,6,7(8-substituted)-tetrahydro-[1,2,4]triazolo[4,3-a]pyrazines as selective NK-3 receptor antagonists, pharmaceutical composition, methods for use in NK-3 receptor mediated disorders and chiral synthesis thereof US Patent US9475814 Publication Date 10/25/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Substance-K receptor |
|---|
| Name: | Substance-K receptor |
|---|
| Synonyms: | NK-2 receptor | NK-2R | NK2R | NK2R_HUMAN | NKNAR | Neurokinin 2 receptor | Neurokinin A receptor | Neurokinin NK2 | Neurokinin-2 (NK-2) | Neuromedin-2 receptor (NK-2R) | SKR | TAC2R | TACR2 | Tachykinin receptor 2 | Tachykinin receptor 2 (NK2) | hnk-3 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 44455.78 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P21452 |
|---|
| Residue: | 398 |
|---|
| Sequence: | MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILA
HRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS
IYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATK
CVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLR
HLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSST
MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMA
GDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI
|
|
|
|---|
| BDBM50081197 |
|---|
| n/a |
|---|
| Name | BDBM50081197 |
|---|
| Synonyms: | CHEMBL3422017 | US10065961, Compound 23 | US10683295, Compound 23 | US10941151, Compound 23 | US9475814, 23 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H18N6O2S |
|---|
| Mol. Mass. | 406.461 |
|---|
| SMILES | C[C@H]1N(CCn2c1nnc2-c1nc(C)no1)C(=O)c1ccc(cc1)-c1cccs1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
