| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Uracil-DNA glycosylase |
|---|
| Ligand | BDBM294522 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Processive DNA synthesis assay |
|---|
| pH | 7.5±n/a |
|---|
| EC50 | 7900±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Ricciardi, RP; Reitz, AB; Parker, MH; Baugh, SD; Nuth, M; Guan, H Antivirals against molluscum contagiosum virus US Patent US10112895 Publication Date 10/30/2018 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Uracil-DNA glycosylase |
|---|
| Name: | Uracil-DNA glycosylase |
|---|
| Synonyms: | OPG116 | UDG | UNG | UNG_VACCW |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 25071.48 |
|---|
| Organism: | Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strainWR)) |
|---|
| Description: | ChEMBL_747132 |
|---|
| Residue: | 218 |
|---|
| Sequence: | MNSVTVSHAPYTITYHDDWEPVMSQLVEFYNEVASWLLRDETSPIPDKFFIQLKQPLRNK
RVCVCGIDPYPKDGTGVPFESPNFTKKSIKEIASSISRLTGVIDYKGYNLNIIDGVIPWN
YYLSCKLGETKSHAIYWDKISKLLLQHITKHVSVLYCLGKTDYSNIRAKLESPVTTIVGY
HPAARDRQFEKDRSFEIINVLLELDNKAPINWAQGFIY
|
|
|
|---|
| BDBM294522 |
|---|
| n/a |
|---|
| Name | BDBM294522 |
|---|
| Synonyms: | N-[(2-benzyloxyphenyl)methyl]- 1H-indazol-5-amine | US10112895, Compound 14 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H19N3O |
|---|
| Mol. Mass. | 329.3951 |
|---|
| SMILES | C(Nc1ccc2[nH]ncc2c1)c1ccccc1OCc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
