| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Steroid hormone receptor ERR1 |
|---|
| Ligand | BDBM22435 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Binding Assay |
|---|
| IC50 | >10000±n/a nM |
|---|
| Citation |  Hwang, SY; Cho, SJ; Kim, J; Chin, J; Hwang, H; Lee, I; Jeon, Y; Lee, J; Jeon, J; Kim, SW Aryl ethene derivative and pharmaceutical composition containing same as active ingredient US Patent US10934303 Publication Date 3/2/2021 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Steroid hormone receptor ERR1 |
|---|
| Name: | Steroid hormone receptor ERR1 |
|---|
| Synonyms: | ERR-alpha | ERR1 | ERR1_HUMAN | ESRL1 | ESRRA | Estrogen receptor-like 1 | Estrogen-Related Receptor, alpha | Estrogen-related receptor alpha | NR3B1 | Nuclear receptor subfamily 3 group B member 1 | Steroid hormone receptor ERR1 | Steroid hormone receptor ERR1 alpha | Steroid hormone receptor ERR1/Estrogen-related receptor alpha (ERRa) | von Hippel-Lindau disease tumor suppressor/Steroid hormone receptor ERR1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 45508.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1499891 |
|---|
| Residue: | 423 |
|---|
| Sequence: | MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAG
PGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNE
CEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGP
LAVAGGPRKTAAPVNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTI
SWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAA
GLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEALL
EYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEA
MMD
|
|
|
|---|
| BDBM22435 |
|---|
| n/a |
|---|
| Name | BDBM22435 |
|---|
| Synonyms: | 4-[(1Z)-1-{4-[2-(dimethylamino)ethoxy]phenyl}-5-hydroxy-2-phenylpent-1-en-1-yl]phenol | 4-hydroxytamoxifen (4-OHT) analog, 15 | GSK 5182 | US10934303, Example GSK5182 | US11285226, Compound GSK5182 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H31NO3 |
|---|
| Mol. Mass. | 417.5399 |
|---|
| SMILES | CN(C)CCOc1ccc(cc1)C(=C(\CCCO)c1ccccc1)\c1ccc(O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
