| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cellular tumor antigen p53 [1-83]/E3 ubiquitin-protein ligase Mdm2 [1-188] |
|---|
| Ligand | BDBM427184 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | MDM2-p53 Interaction Using a 96-Well Plate Binding Assay (ELISA) |
|---|
| IC50 | 1.90±n/a nM |
|---|
| Citation |  Chessari, G; Howard, S; Buck, IM; Cons, BD; Johnson, CN; Holvey, RS; Rees, DC; St. Denis, JD; Tamanini, E; Golding, BT; Hardcastle, IR; Cano, CF; Miller, DC; Noble, ME; Griffin, RJ; Osborne, JD; Peach, J; Lewis, A; Hirst, KL; Whittaker, BP; Watson, DW; Mitchell, DR Isoindolinone inhibitors of the MDM2-p53 interaction having anticancer activity US Patent US10981898 Publication Date 4/20/2021 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cellular tumor antigen p53 [1-83]/E3 ubiquitin-protein ligase Mdm2 [1-188] |
|---|
| Name: | Cellular tumor antigen p53 [1-83]/E3 ubiquitin-protein ligase Mdm2 [1-188] |
|---|
| Synonyms: | MDM2 and p53 | mdm2 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | E3 ubiquitin-protein ligase Mdm2 [1-188] |
|---|
| Synonyms: | E3 ubiquitin-protein ligase Mdm2 (aa 1-188) | MDM2 | MDM2_HUMAN |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 21319.18 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q00987[1-188] |
|---|
| Residue: | 188 |
|---|
| Sequence: | MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGT
SVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQ
RKRHKSDS
|
|
|
|---|
| Component 2 |
| Name: | Cellular tumor antigen p53 [1-83] |
|---|
| Synonyms: | P53 | P53_HUMAN | TP53 | Tumor suppressor p53 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 8975.74 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Residues 1-83 |
|---|
| Residue: | 83 |
|---|
| Sequence: | MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP
DEAPRMPEAAPPVAPAPAAPTPA
|
|
|
|---|
| BDBM427184 |
|---|
| n/a |
|---|
| Name | BDBM427184 |
|---|
| Synonyms: | US10544132, Example 125 | US10981898, Example 126 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H29Cl2F2NO6 |
|---|
| Mol. Mass. | 620.468 |
|---|
| SMILES | CC[C@](C)(O)c1cc2C(=O)N([C@@H](CC(O)=O)c3ccc(Cl)cc3)[C@](OCC3(F)COC3)(c2c(F)c1)c1ccc(Cl)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
