Target/Host (Institution) | Ligand | Target/Host Links | Ligand Links | Trg + Lig Links | Ki nM | ΔG° kJ/mole | IC50 nM | Kd nM | EC50/IC50 nM | koff s-1 | kon M-1s-1 | pH | Temp °C |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Glutathione S-transferase omega-1 (Homo sapiens (Human)) | BDBM50526135 (CHEMBL4593975) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 0.220 | n/a | n/a | n/a | n/a | n/a | n/a |
Sichuan University Curated by ChEMBL | Assay Description Inhibition of CMFDA binding to human N-terminal 6x-His-tagged GSTO1-1 preincubated for 30 mins followed by CMFDA addition and measured after 30 mins ... | J Med Chem 62: 3068-3087 (2019) Article DOI: 10.1021/acs.jmedchem.8b01960 BindingDB Entry DOI: 10.7270/Q2TQ64ZS | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM387172 (3-(5-((5-chloro-2-((1-(6-methoxypyridin-3-yl)-1H-p...) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | <0.300 | n/a | n/a | n/a | n/a | n/a | n/a |
GSK | Assay Description JAK1:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding white... | J Med Chem 51: 4632-40 (2008) BindingDB Entry DOI: 10.7270/Q2X350S7 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Glutathione S-transferase omega-1 (Homo sapiens (Human)) | BDBM50526136 (CHEMBL4513682) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 0.320 | n/a | n/a | n/a | n/a | n/a | n/a |
Sichuan University Curated by ChEMBL | Assay Description Inhibition of CMFDA binding to human N-terminal 6x-His-tagged GSTO1-1 preincubated for 30 mins followed by CMFDA addition and measured after 30 mins ... | J Med Chem 62: 3068-3087 (2019) Article DOI: 10.1021/acs.jmedchem.8b01960 BindingDB Entry DOI: 10.7270/Q2TQ64ZS | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM239977 (US9403801, 48) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 0.400 | n/a | n/a | n/a | n/a | 7.5 | 25 |
CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD. US Patent | Assay Description JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app... | US Patent US9403801 (2016) BindingDB Entry DOI: 10.7270/Q200011G | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM239968 (US9403801, 33) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 0.400 | n/a | n/a | n/a | n/a | 7.5 | 25 |
CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD. US Patent | Assay Description JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app... | US Patent US9403801 (2016) BindingDB Entry DOI: 10.7270/Q200011G | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM239976 (US9403801, 46) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 0.5 | n/a | n/a | n/a | n/a | 7.5 | 25 |
CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD. US Patent | Assay Description JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app... | US Patent US9403801 (2016) BindingDB Entry DOI: 10.7270/Q200011G | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Aurora kinase B (Homo sapiens (Human)) | BDBM387194 (5-((5-chloro-2-((1-(2-hydroxypropyl)-1H-pyrazol-4-...) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 0.600 | n/a | n/a | n/a | n/a | n/a | n/a |
GSK | Assay Description Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w... | J Med Chem 51: 4632-40 (2008) BindingDB Entry DOI: 10.7270/Q2X350S7 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM387171 (3-(5-((5-chloro-2-((1-(pyridin-2-yl)-1H-pyrazol-4-...) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 0.600 | n/a | n/a | n/a | n/a | n/a | n/a |
GSK | Assay Description JAK1:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding white... | J Med Chem 51: 4632-40 (2008) BindingDB Entry DOI: 10.7270/Q2X350S7 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Aurora kinase B (Homo sapiens (Human)) | BDBM387182 (5-((5-chloro-2-((1-methyl-1H-pyrazol-4-yl)amino)py...) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 0.700 | n/a | n/a | n/a | n/a | n/a | n/a |
GSK | Assay Description Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w... | J Med Chem 51: 4632-40 (2008) BindingDB Entry DOI: 10.7270/Q2X350S7 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Aurora kinase B (Homo sapiens (Human)) | BDBM387192 (5-((5-chloro-2-((1-(2-hydroxypropyl)-1H-pyrazol-4-...) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 0.800 | n/a | n/a | n/a | n/a | n/a | n/a |
GSK | Assay Description Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w... | J Med Chem 51: 4632-40 (2008) BindingDB Entry DOI: 10.7270/Q2X350S7 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Aurora kinase B (Homo sapiens (Human)) | BDBM387184 (5-((5-chloro-2-((1-methyl-1H-pyrazol-4-yl)amino)py...) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 0.800 | n/a | n/a | n/a | n/a | n/a | n/a |
GSK | Assay Description Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w... | J Med Chem 51: 4632-40 (2008) BindingDB Entry DOI: 10.7270/Q2X350S7 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM239955 (US9403801, 14A | US9403801, 14B) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 0.800 | n/a | n/a | n/a | n/a | 7.5 | 25 |
CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD. US Patent | Assay Description JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app... | US Patent US9403801 (2016) BindingDB Entry DOI: 10.7270/Q200011G | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Aurora kinase A (Homo sapiens (Human)) | BDBM387186 (1-(4-((5-chloro-4-((2-(methyl sulfonyl)octahydrocy...) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 0.800 | n/a | n/a | n/a | n/a | n/a | n/a |
GSK | Assay Description Aurora-A:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w... | J Med Chem 51: 4632-40 (2008) BindingDB Entry DOI: 10.7270/Q2X350S7 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM239965 (US9403801, 30) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 0.900 | n/a | n/a | n/a | n/a | 7.5 | 25 |
CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD. US Patent | Assay Description JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app... | US Patent US9403801 (2016) BindingDB Entry DOI: 10.7270/Q200011G | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM239963 (US9403801, 28) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 0.900 | n/a | n/a | n/a | n/a | 7.5 | 25 |
CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD. US Patent | Assay Description JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app... | US Patent US9403801 (2016) BindingDB Entry DOI: 10.7270/Q200011G | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Aurora kinase B (Homo sapiens (Human)) | BDBM387181 (5-((5-chloro-2-((1-methyl-1H-pyrazol-4-yl)amino)py...) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 1 | n/a | n/a | n/a | n/a | n/a | n/a |
GSK | Assay Description Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w... | J Med Chem 51: 4632-40 (2008) BindingDB Entry DOI: 10.7270/Q2X350S7 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Aurora kinase B (Homo sapiens (Human)) | BDBM387186 (1-(4-((5-chloro-4-((2-(methyl sulfonyl)octahydrocy...) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 1 | n/a | n/a | n/a | n/a | n/a | n/a |
GSK | Assay Description Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w... | J Med Chem 51: 4632-40 (2008) BindingDB Entry DOI: 10.7270/Q2X350S7 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Aurora kinase B (Homo sapiens (Human)) | BDBM387187 (1-(4-((5-chloro-4-((2-(methyl sulfonyl)octahydrocy...) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 1 | n/a | n/a | n/a | n/a | n/a | n/a |
GSK | Assay Description Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w... | J Med Chem 51: 4632-40 (2008) BindingDB Entry DOI: 10.7270/Q2X350S7 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Aurora kinase B (Homo sapiens (Human)) | BDBM387191 (1-(4-((5-chloro-4-((2-(cyclopropylsulfonyl)octahyd...) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 1 | n/a | n/a | n/a | n/a | n/a | n/a |
GSK | Assay Description Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w... | J Med Chem 51: 4632-40 (2008) BindingDB Entry DOI: 10.7270/Q2X350S7 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Aurora kinase B (Homo sapiens (Human)) | BDBM387193 (1-(4-((5-chloro-4-((2-((cyclopropylmethyl)sulfonyl...) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 1 | n/a | n/a | n/a | n/a | n/a | n/a |
GSK | Assay Description Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w... | J Med Chem 51: 4632-40 (2008) BindingDB Entry DOI: 10.7270/Q2X350S7 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM387186 (1-(4-((5-chloro-4-((2-(methyl sulfonyl)octahydrocy...) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 1 | n/a | n/a | n/a | n/a | n/a | n/a |
GSK | Assay Description JAK1:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding white... | J Med Chem 51: 4632-40 (2008) BindingDB Entry DOI: 10.7270/Q2X350S7 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM239981 (US9403801, 59) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 1 | n/a | n/a | n/a | n/a | 7.5 | 25 |
CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD. US Patent | Assay Description JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app... | US Patent US9403801 (2016) BindingDB Entry DOI: 10.7270/Q200011G | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Non-receptor tyrosine-protein kinase TYK2 (Homo sapiens (Human)) | BDBM239955 (US9403801, 14A | US9403801, 14B) | PDB KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 1 | n/a | n/a | n/a | n/a | 7.0 | 25 |
CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD. US Patent | Assay Description TYK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx... | US Patent US9403801 (2016) BindingDB Entry DOI: 10.7270/Q200011G | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM239953 (US9403801, 12) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 1 | n/a | n/a | n/a | n/a | 7.5 | 25 |
CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD. US Patent | Assay Description JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app... | US Patent US9403801 (2016) BindingDB Entry DOI: 10.7270/Q200011G | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Aurora kinase A (Homo sapiens (Human)) | BDBM387184 (5-((5-chloro-2-((1-methyl-1H-pyrazol-4-yl)amino)py...) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 1 | n/a | n/a | n/a | n/a | n/a | n/a |
GSK | Assay Description Aurora-A:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w... | J Med Chem 51: 4632-40 (2008) BindingDB Entry DOI: 10.7270/Q2X350S7 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM239966 (US9403801, 31) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 1 | n/a | n/a | n/a | n/a | 7.5 | 25 |
CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD. US Patent | Assay Description JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app... | US Patent US9403801 (2016) BindingDB Entry DOI: 10.7270/Q200011G | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Aurora kinase B (Homo sapiens (Human)) | BDBM387177 (US9938257, Example 15 | ethyl 5-((5-chloro-2-((1-m...) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | n/a | n/a |
GSK | Assay Description Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w... | J Med Chem 51: 4632-40 (2008) BindingDB Entry DOI: 10.7270/Q2X350S7 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Aurora kinase A (Homo sapiens (Human)) | BDBM387187 (1-(4-((5-chloro-4-((2-(methyl sulfonyl)octahydrocy...) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | n/a | n/a |
GSK | Assay Description Aurora-A:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w... | J Med Chem 51: 4632-40 (2008) BindingDB Entry DOI: 10.7270/Q2X350S7 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM239969 (US9403801, 34) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | 7.5 | 25 |
CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD. US Patent | Assay Description JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app... | US Patent US9403801 (2016) BindingDB Entry DOI: 10.7270/Q200011G | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM239970 (US9403801, 35) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | 7.5 | 25 |
CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD. US Patent | Assay Description JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app... | US Patent US9403801 (2016) BindingDB Entry DOI: 10.7270/Q200011G | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM239985 (US9403801, 64) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | 7.5 | 25 |
CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD. US Patent | Assay Description JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app... | US Patent US9403801 (2016) BindingDB Entry DOI: 10.7270/Q200011G | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM239954 (US9403801, 13.3A | US9403801, 13.3B) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | 7.5 | 25 |
CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD. US Patent | Assay Description JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app... | US Patent US9403801 (2016) BindingDB Entry DOI: 10.7270/Q200011G | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM239954 (US9403801, 13.3A | US9403801, 13.3B) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | 7.5 | 25 |
CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD. US Patent | Assay Description JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app... | US Patent US9403801 (2016) BindingDB Entry DOI: 10.7270/Q200011G | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM239955 (US9403801, 14A | US9403801, 14B) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | 7.5 | 25 |
CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD. US Patent | Assay Description JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app... | US Patent US9403801 (2016) BindingDB Entry DOI: 10.7270/Q200011G | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM239958 (US9403801, 22) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | 7.5 | 25 |
CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD. US Patent | Assay Description JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app... | US Patent US9403801 (2016) BindingDB Entry DOI: 10.7270/Q200011G | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM239961 (US9403801, 26) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | 7.5 | 25 |
CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD. US Patent | Assay Description JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app... | US Patent US9403801 (2016) BindingDB Entry DOI: 10.7270/Q200011G | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM239964 (US9403801, 29) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | 7.5 | 25 |
CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD. US Patent | Assay Description JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app... | US Patent US9403801 (2016) BindingDB Entry DOI: 10.7270/Q200011G | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM387170 (3-(5-((5-chloro-2-((1-(2-hydroxy-2-methylpropyl)-1...) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | n/a | n/a |
GSK | Assay Description JAK1:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding white... | J Med Chem 51: 4632-40 (2008) BindingDB Entry DOI: 10.7270/Q2X350S7 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM387182 (5-((5-chloro-2-((1-methyl-1H-pyrazol-4-yl)amino)py...) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | n/a | n/a |
GSK | Assay Description JAK1:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding white... | J Med Chem 51: 4632-40 (2008) BindingDB Entry DOI: 10.7270/Q2X350S7 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM387185 (1-(4-((5-chloro-4-((3-(methylsulfonyl)-3-azaspiro[...) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | n/a | n/a |
GSK | Assay Description JAK1:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding white... | J Med Chem 51: 4632-40 (2008) BindingDB Entry DOI: 10.7270/Q2X350S7 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM387187 (1-(4-((5-chloro-4-((2-(methyl sulfonyl)octahydrocy...) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | n/a | n/a |
GSK | Assay Description JAK1:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding white... | J Med Chem 51: 4632-40 (2008) BindingDB Entry DOI: 10.7270/Q2X350S7 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Aurora kinase B (Homo sapiens (Human)) | BDBM387180 (5-((5-chloro-2-((1-methyl-1H-pyrazol-4-yl)amino)py...) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 2 | n/a | n/a | n/a | n/a | n/a | n/a |
GSK | Assay Description Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w... | J Med Chem 51: 4632-40 (2008) BindingDB Entry DOI: 10.7270/Q2X350S7 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM239967 (US9403801, 32) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 3 | n/a | n/a | n/a | n/a | 7.5 | 25 |
CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD. US Patent | Assay Description JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app... | US Patent US9403801 (2016) BindingDB Entry DOI: 10.7270/Q200011G | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM239974 (US9403801, 42) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 3 | n/a | n/a | n/a | n/a | 7.5 | 25 |
CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD. US Patent | Assay Description JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app... | US Patent US9403801 (2016) BindingDB Entry DOI: 10.7270/Q200011G | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM387184 (5-((5-chloro-2-((1-methyl-1H-pyrazol-4-yl)amino)py...) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 3 | n/a | n/a | n/a | n/a | n/a | n/a |
GSK | Assay Description JAK1:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding white... | J Med Chem 51: 4632-40 (2008) BindingDB Entry DOI: 10.7270/Q2X350S7 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM239957 (US9403801, 20) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 3 | n/a | n/a | n/a | n/a | 7.5 | 25 |
CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD. US Patent | Assay Description JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app... | US Patent US9403801 (2016) BindingDB Entry DOI: 10.7270/Q200011G | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Aurora kinase A (Homo sapiens (Human)) | BDBM387182 (5-((5-chloro-2-((1-methyl-1H-pyrazol-4-yl)amino)py...) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 3 | n/a | n/a | n/a | n/a | n/a | n/a |
GSK | Assay Description Aurora-A:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w... | J Med Chem 51: 4632-40 (2008) BindingDB Entry DOI: 10.7270/Q2X350S7 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK2 (Homo sapiens (Human)) | BDBM239968 (US9403801, 33) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 3 | n/a | n/a | n/a | n/a | 7.0 | 25 |
CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD. US Patent | Assay Description JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s... | US Patent US9403801 (2016) BindingDB Entry DOI: 10.7270/Q200011G | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Glycogen synthase kinase-3 beta (Homo sapiens (Human)) | BDBM50147472 (3-[1-(3-Hydroxy-propyl)-1H-pyrrolo[2,3-b]pyridin-3...) | PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | CHEMBL PC cid PC sid UniChem Patents Similars | Article PubMed | n/a | n/a | 4 | n/a | n/a | n/a | n/a | n/a | n/a |
Wuhan Institute of Technology Curated by ChEMBL | Assay Description Inhibition of human Protein kinase C alpha | Eur J Med Chem 164: 448-470 (2019) Article DOI: 10.1016/j.ejmech.2018.12.073 BindingDB Entry DOI: 10.7270/Q2WH2SVB | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Tyrosine-protein kinase JAK1 (Homo sapiens (Human)) | BDBM239984 (US9403801, 62) | PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | US Patent | n/a | n/a | 4 | n/a | n/a | n/a | n/a | 7.5 | 25 |
CALITOR SCIENCES, LLC; SUNSHINE LAKE PHARMA CO., LTD. US Patent | Assay Description JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app... | US Patent US9403801 (2016) BindingDB Entry DOI: 10.7270/Q200011G | |||||||||||
More data for this Ligand-Target Pair |
Displayed 1 to 50 (of 385 total ) | Next | Last >> |