| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine protease 1 |
|---|
| Ligand | BDBM14331 |
|---|
| Substrate/Competitor | BDBM12679 |
|---|
| Meas. Tech. | Enzyme Assay and Determination of the Inhibition Constants |
|---|
| pH | 6.7±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| Ki | 170±n/a nM |
|---|
| Comments | pH where Ki is lowest (pH(min)), and Ki(min) toward bovine trypsin. |
|---|
| Citation |  Katz, BA; Elrod, K; Verner, E; Mackman, RL; Luong, C; Shrader, WD; Sendzik, M; Spencer, JR; Sprengeler, PA; Kolesnikov, A; Tai, VW; Hui, HC; Breitenbucher, JG; Allen, D; Janc, JW Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors. J Mol Biol329:93-120 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Serine protease 1 |
|---|
| Name: | Serine protease 1 |
|---|
| Synonyms: | Beta-Trypsin | Cationic trypsin | PRSS1 | TRP1 | TRY1 | TRY1_BOVIN | TRYP1 | Trypsin | Trypsin I |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 25790.52 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | P00760 |
|---|
| Residue: | 246 |
|---|
| Sequence: | MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
|
|
|
|---|
| BDBM14331 |
|---|
| BDBM12679 |
|---|
| Name | BDBM14331 |
|---|
| Synonyms: | 2-{5-[amino(iminiumyl)methyl]-1H-1,3-benzodiazol-2-yl}-6-bromo-4-methylbenzen-1-olate | CRA-9334 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H13BrN4O |
|---|
| Mol. Mass. | 345.194 |
|---|
| SMILES | Cc1cc(Br)c([O-])c(c1)-c1nc2ccc(cc2[nH]1)C(N)=[NH2+] |
|---|
| Structure | 
|
|---|
Search and Browse
