Reaction Details |
| Report a problem with these data |
Target | Isocitrate dehydrogenase [NADP] cytoplasmic [R132H] |
---|
Ligand | BDBM375186 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | IDH1-R132H and IDH1-R132C Enzymatic Assay |
---|
IC50 | 550±n/a nM |
---|
Citation | Lin, J; Ericsson, A; Campbell, A; Gustafson, G; Wang, Z; Diebold, RB; Ashwell, S; Lancia, Jr., DR; Caravella, JA; Lu, W Pyridinyl quinolinone derivatives as mutant-isocitrate dehydrogenase inhibitors US Patent US10253015 Publication Date 4/9/2019 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Isocitrate dehydrogenase [NADP] cytoplasmic [R132H] |
---|
Name: | Isocitrate dehydrogenase [NADP] cytoplasmic [R132H] |
Synonyms: | Cytosolic NADP-isocitrate dehydrogenase (IDH1)(R132H) | IDH1 | IDH1 R132H | IDH1(R132H) | IDHC_HUMAN | Isocitrate dehydrogenase (IDH1)(R132H) | Isocitrate dehydrogenase 1 mutant (R132H) | Isocitrate dehydrogenase [NADP] cytoplasmic (IDH)(R132H) | Isocitrate dehydrogenase [NADP] cytoplasmic (IDH1)(R132H) | Isocitrate dehydrogenase [NADP] cytoplasmic (R132H) | PICD |
Type: | Protein |
Mol. Mass.: | 46641.74 |
Organism: | Homo sapiens (Human) |
Description: | Human IDH1 R132H (SEQ ID No. 2 in patent). First three are removed. Google patent parsed wrong. |
Residue: | 414 |
Sequence: | MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VSGWVKPIIIGHHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAM
GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE
AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE
EVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL
|
|
|
BDBM375186 |
---|
n/a |
---|
Name | BDBM375186 |
Synonyms: | 6-chloro-3-[(1S)-1-{[3-fluoro-4-(4- | US10253015, Compound I-46 |
Type | Small organic molecule |
Emp. Form. | C21H17ClFN3OS |
Mol. Mass. | 413.896 |
SMILES | C[C@H](Nc1nccc(-c2cscc2C)c1F)c1cc2cc(Cl)ccc2[nH]c1=O |r| |
Structure |
|