Reaction Details |
| Report a problem with these data |
Target | High affinity nerve growth factor receptor [440-796] |
---|
Ligand | BDBM27890 |
---|
Substrate/Competitor | polyGlu4Tyr |
---|
Meas. Tech. | TrkA Enzyme Inhibition Assay |
---|
Temperature | 298.15±n/a K |
---|
IC50 | 170±n/a nM |
---|
Comments | extracted |
---|
Citation | Huang, H; Hutta, DA; Rinker, JM; Hu, H; Parsons, WH; Schubert, C; Desjarlais, RL; Crysler, CS; Chaikin, MA; Donatelli, RR; Chen, Y; Cheng, D; Zhou, Z; Yurkow, E; Manthey, CL; Player, MR Pyrido[2,3-d]pyrimidin-5-ones: A Novel Class of Antiinflammatory Macrophage Colony-Stimulating Factor-1 Receptor Inhibitors (dagger). J Med Chem52:1081-99 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
High affinity nerve growth factor receptor [440-796] |
---|
Name: | High affinity nerve growth factor receptor [440-796] |
Synonyms: | High affinity nerve growth factor receptor | MTC | NTRK1 | NTRK1_HUMAN | Neurotrophic tyrosine kinase receptor type 1 | TRK | TRK1-transforming tyrosine kinase protein | TRKA | Tyrosine Kinase TrkA | p140-TrkA |
Type: | Cytoplasmic region |
Mol. Mass.: | 40053.30 |
Organism: | Homo sapiens (Human) |
Description: | The histidine-tagged recombinant human TrkA cytoplasmic domain (amino acids 440-796) expressed in insect cells was used in enzyme assays. |
Residue: | 357 |
Sequence: | NKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSD
ACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQR
EAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAP
GPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTD
YYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDC
ITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
|
|
|
BDBM27890 |
---|
polyGlu4Tyr |
---|
Name: | polyGlu4Tyr |
Synonyms: | n/a |
Type: | Random copolymer |
Mol. Mass.: | 358.43 |
Organism: | n/a |
Description: | n/a |
Residue: | 3 |
Sequence: | |