Reaction Details |
| Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM705 |
---|
Substrate/Competitor | HIV-1 Protease substrate |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
pH | 6±n/a |
---|
Temperature | 310.15±n/a K |
---|
Comments | At inhibitor concentrition of 5 uM, 82% protease activity is inhibited. |
---|
Citation | Mimoto, T; Kato, R; Takaku, H; Nojima, S; Terashima, K; Misawa, S; Fukazawa, T; Ueno, T; Sato, H; Shintani, M; Kiso, Y; Hayashi, H Structure-activity relationship of small-sized HIV protease inhibitors containing allophenylnorstatine. J Med Chem42:1789-802 (1999) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [489-587] |
---|
Name: | Dimer of Gag-Pol polyprotein [489-587] |
Synonyms: | HIV-1 Protease |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | HIV protease | HIV-1 Protease (NY5-type sequence) | HIV-1 Protease chain A | HIV-1 Protease chain B | POL_HV1N5 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10822.21 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P12497[489-587] |
Residue: | 99 |
Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | HIV protease | HIV-1 Protease (NY5-type sequence) | HIV-1 Protease chain A | HIV-1 Protease chain B | POL_HV1N5 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10822.21 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P12497[489-587] |
Residue: | 99 |
Sequence: | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM705 |
---|
HIV-1 Protease substrate |
---|
Name: | HIV-1 Protease substrate |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 2535.82 |
Organism: | Synthetic peptide |
Description: | n/a |
Residue: | 22 |
Sequence: | H-Ser-Gln-Asn-Tyr-Pro-Ile-Val-OH
|
|
|