| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Pteridine reductase |
|---|
| Ligand | BDBM7960 |
|---|
| Substrate/Competitor | BDBM31792 |
|---|
| Meas. Tech. | PTR1 Activity Assay |
|---|
| pH | 6±n/a |
|---|
| Temperature | 296.15±n/a K |
|---|
| Ki | 288000±n/a nM |
|---|
| Citation |  Mpamhanga, CP; Spinks, D; Tulloch, LB; Shanks, EJ; Robinson, DA; Collie, IT; Fairlamb, AH; Wyatt, PG; Frearson, JA; Hunter, WN; Gilbert, IH; Brenk, R One scaffold, three binding modes: novel and selective pteridine reductase 1 inhibitors derived from fragment hits discovered by virtual screening. J Med Chem52:4454-65 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Pteridine reductase |
|---|
| Name: | Pteridine reductase |
|---|
| Synonyms: | Pteridine Reductase 1 (PTR1) | TbPTR1 |
|---|
| Type: | Oxidoreductase |
|---|
| Mol. Mass.: | 28470.17 |
|---|
| Organism: | Trypanosoma brucei brucei |
|---|
| Description: | n/a |
|---|
| Residue: | 268 |
|---|
| Sequence: | MEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQ
ADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQV
AELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHA
LVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADA
VIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
|
|---|
| BDBM7960 |
|---|
| BDBM31792 |
|---|
| Name | BDBM7960 |
|---|
| Synonyms: | 1H-1,3-benzodiazol-2-amine | 2-Aminobenzimidazole | CHEMBL305513 | CRA Fragment 9 | Imidazole C-2 deriv. 3 | JMC524454 Compound 5 | US11584714, Compound 46 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C7H7N3 |
|---|
| Mol. Mass. | 133.1506 |
|---|
| SMILES | Nc1nc2ccccc2[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
