Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Pteridine reductase |
---|
Ligand | BDBM31795 |
---|
Substrate/Competitor | BDBM31792 |
---|
Meas. Tech. | PTR1 Activity Assay |
---|
pH | 6±n/a |
---|
Temperature | 296.15±n/a K |
---|
Ki | 9800±n/a nM |
---|
Citation | Mpamhanga, CP; Spinks, D; Tulloch, LB; Shanks, EJ; Robinson, DA; Collie, IT; Fairlamb, AH; Wyatt, PG; Frearson, JA; Hunter, WN; Gilbert, IH; Brenk, R One scaffold, three binding modes: novel and selective pteridine reductase 1 inhibitors derived from fragment hits discovered by virtual screening. J Med Chem52:4454-65 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Pteridine reductase |
---|
Name: | Pteridine reductase |
Synonyms: | Pteridine Reductase 1 (PTR1) | TbPTR1 |
Type: | Oxidoreductase |
Mol. Mass.: | 28470.17 |
Organism: | Trypanosoma brucei brucei |
Description: | n/a |
Residue: | 268 |
Sequence: | MEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQ
ADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQV
AELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHA
LVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADA
VIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
|
BDBM31795 |
---|
BDBM31792 |
---|
Name | BDBM31795 |
Synonyms: | 2-aminobenzimidazole deriv., 6 |
Type | Small organic molecule |
Emp. Form. | C14H13N3 |
Mol. Mass. | 223.2731 |
SMILES | Cc1cccc(c1)-c1ccc2nc(N)[nH]c2c1 |
Structure |
|