Reaction Details |
| Report a problem with these data |
Target | Translocator protein |
---|
Ligand | BDBM220447 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1670402 (CHEMBL4020290) |
---|
IC50 | 800±n/a nM |
---|
Citation | McDaniel, KF; Wang, L; Soltwedel, T; Fidanze, SD; Hasvold, LA; Liu, D; Mantei, RA; Pratt, JK; Sheppard, GS; Bui, MH; Faivre, EJ; Huang, X; Li, L; Lin, X; Wang, R; Warder, SE; Wilcox, D; Albert, DH; Magoc, TJ; Rajaraman, G; Park, CH; Hutchins, CW; Shen, JJ; Edalji, RP; Sun, CC; Martin, R; Gao, W; Wong, S; Fang, G; Elmore, SW; Shen, Y; Kati, WM Discovery of N-(4-(2,4-Difluorophenoxy)-3-(6-methyl-7-oxo-6,7-dihydro-1H-pyrrolo[2,3-c]pyridin-4-yl)phenyl)ethanesulfonamide (ABBV-075/Mivebresib), a Potent and Orally Available Bromodomain and Extraterminal Domain (BET) Family Bromodomain Inhibitor. J Med Chem60:8369-8384 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Translocator protein |
---|
Name: | Translocator protein |
Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
Type: | Enzyme |
Mol. Mass.: | 18834.74 |
Organism: | Homo sapiens (Human) |
Description: | P30536 |
Residue: | 169 |
Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
BDBM220447 |
---|
n/a |
---|
Name | BDBM220447 |
Synonyms: | US10633379, Compound X | US9296741, 36 |
Type | Small organic molecule |
Emp. Form. | C22H19F2N3O4S |
Mol. Mass. | 459.466 |
SMILES | CCS(=O)(=O)Nc1ccc(Oc2ccc(F)cc2F)c(c1)-c1cn(C)c(=O)c2[nH]ccc12 |
Structure |
|