Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Cyclin-dependent kinase 1 |
---|
Ligand | BDBM50325983 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1672658 (CHEMBL4022687) |
---|
IC50 | 8800±n/a nM |
---|
Citation | Wagman, AS; Boyce, RS; Brown, SP; Fang, E; Goff, D; Jansen, JM; Le, VP; Levine, BH; Ng, SC; Ni, ZJ; Nuss, JM; Pfister, KB; Ramurthy, S; Renhowe, PA; Ring, DB; Shu, W; Subramanian, S; Zhou, XA; Shafer, CM; Harrison, SD; Johnson, KW; Bussiere, DE Synthesis, Binding Mode, and Antihyperglycemic Activity of Potent and Selective (5-Imidazol-2-yl-4-phenylpyrimidin-2-yl)[2-(2-pyridylamino)ethyl]amine Inhibitors of Glycogen Synthase Kinase 3. J Med Chem60:8482-8514 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cyclin-dependent kinase 1 |
---|
Name: | Cyclin-dependent kinase 1 |
Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
Type: | Enzyme Subunit |
Mol. Mass.: | 34101.08 |
Organism: | Homo sapiens (Human) |
Description: | P06493 |
Residue: | 297 |
Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
BDBM50325983 |
---|
n/a |
---|
Name | BDBM50325983 |
Synonyms: | 6-(2-(4-(2,4-dichlorophenyl)-5-(4-methyl-1H-imidazol-2-yl)pyrimidin-2-ylamino)ethylamino)nicotinonitrile | CHEMBL412142 | CHIR-99021 | CT 99021 | US11203601, Compound Table 1.19 |
Type | Small organic molecule |
Emp. Form. | C22H18Cl2N8 |
Mol. Mass. | 465.338 |
SMILES | Cc1c[nH]c(n1)-c1cnc(NCCNc2ccc(cn2)C#N)nc1-c1ccc(Cl)cc1Cl |
Structure |
|