| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 1 |
|---|
| Ligand | BDBM50243389 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1672658 (CHEMBL4022687) |
|---|
| IC50 | 4000±n/a nM |
|---|
| Citation |  Wagman, AS; Boyce, RS; Brown, SP; Fang, E; Goff, D; Jansen, JM; Le, VP; Levine, BH; Ng, SC; Ni, ZJ; Nuss, JM; Pfister, KB; Ramurthy, S; Renhowe, PA; Ring, DB; Shu, W; Subramanian, S; Zhou, XA; Shafer, CM; Harrison, SD; Johnson, KW; Bussiere, DE Synthesis, Binding Mode, and Antihyperglycemic Activity of Potent and Selective (5-Imidazol-2-yl-4-phenylpyrimidin-2-yl)[2-(2-pyridylamino)ethyl]amine Inhibitors of Glycogen Synthase Kinase 3. J Med Chem60:8482-8514 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 1 |
|---|
| Name: | Cyclin-dependent kinase 1 |
|---|
| Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 34101.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P06493 |
|---|
| Residue: | 297 |
|---|
| Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
|---|
| BDBM50243389 |
|---|
| n/a |
|---|
| Name | BDBM50243389 |
|---|
| Synonyms: | CHEMBL3185148 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H17Cl2N9O2 |
|---|
| Mol. Mass. | 486.314 |
|---|
| SMILES | Nc1nc(NCCNc2ncc(c(n2)-c2ccc(Cl)cc2Cl)-n2ccnc2)ccc1[N+]([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
