Reaction Details |
| Report a problem with these data |
Target | Protease |
---|
Ligand | BDBM50288363 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1729863 (CHEMBL4145141) |
---|
EC50 | 1.2±n/a nM |
---|
Citation | Hidaka, K; Kimura, T; Sankaranarayanan, R; Wang, J; McDaniel, KF; Kempf, DJ; Kameoka, M; Adachi, M; Kuroki, R; Nguyen, JT; Hayashi, Y; Kiso, Y Identification of Highly Potent Human Immunodeficiency Virus Type-1 Protease Inhibitors against Lopinavir and Darunavir Resistant Viruses from Allophenylnorstatine-Based Peptidomimetics with P2 Tetrahydrofuranylglycine. J Med Chem61:5138-5153 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protease |
---|
Name: | Protease |
Synonyms: | n/a |
Type: | Enzyme |
Mol. Mass.: | 10904.79 |
Organism: | Human immunodeficiency virus 1 (HIV-1) |
Description: | Q9YQ12 |
Residue: | 99 |
Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50288363 |
---|
n/a |
---|
Name | BDBM50288363 |
Synonyms: | CHEMBL4173216 |
Type | Small organic molecule |
Emp. Form. | C41H48N4O8S |
Mol. Mass. | 756.907 |
SMILES | [H][C@@](NC(=O)c1cc2cccc(OC)c2o1)(C(=O)N[C@@H](Cc1ccccc1)[C@H](O)C(=O)N1CSC(C)(C)[C@H]1C(=O)NCc1c(C)cccc1C)[C@@]1([H])CCOC1 |r| |
Structure |
|