Reaction Details |
| Report a problem with these data |
Target | Growth hormone secretagogue receptor type 1 |
---|
Ligand | BDBM50477760 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_458616 (CHEMBL941945) |
---|
EC50 | 158±n/a nM |
---|
Citation | Heightman, TD; Scott, JS; Longley, M; Bordas, V; Dean, DK; Elliott, R; Hutley, G; Witherington, J; Abberley, L; Passingham, B; Berlanga, M; de Los Frailes, M; Wise, A; Powney, B; Muir, A; McKay, F; Butler, S; Winborn, K; Gardner, C; Darton, J; Campbell, C; Sanger, G Potent achiral agonists of the ghrelin (growth hormone secretagogue) receptor. Part I: Lead identification. Bioorg Med Chem Lett17:6584-7 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Growth hormone secretagogue receptor type 1 |
---|
Name: | Growth hormone secretagogue receptor type 1 |
Synonyms: | GH-releasing peptide receptor | GHRP | GHS-R | GHSR | GHSR_HUMAN | Ghrelin Receptor (Growth Hormone Secretagogue Receptor Type 1) | Ghrelin receptor | Ghrelin receptor 1a (GHS-R1a) |
Type: | Receptor |
Mol. Mass.: | 41334.57 |
Organism: | Homo sapiens (Human) |
Description: | Receptor binding studies use plasma membranes from LLC PK-1 cells transiently transfected with hGHSR1a. |
Residue: | 366 |
Sequence: | MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
|
|
|
BDBM50477760 |
---|
n/a |
---|
Name | BDBM50477760 |
Synonyms: | CHEMBL250973 |
Type | Small organic molecule |
Emp. Form. | C26H34ClN3O3 |
Mol. Mass. | 472.019 |
SMILES | CCOc1ccc(CC(=O)N2CCc3cc(OC)c(cc23)N2C[C@H](C)N(C)[C@H](C)C2)cc1Cl |
Structure |
|