| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase |
|---|
| Ligand | BDBM50478732 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_552634 (CHEMBL957279) |
|---|
| IC50 | 740±n/a nM |
|---|
| Citation |  Cesarini, S; Spallarossa, A; Ranise, A; Schenone, S; Bruno, O; La Colla, P; Casula, L; Collu, G; Sanna, G; Loddo, R Parallel one-pot synthesis and structure-activity relationship study of symmetric formimidoester disulfides as a novel class of potent non-nucleoside HIV-1 reverse transcriptase inhibitors. Bioorg Med Chem16:6353-63 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase |
|---|
| Name: | Reverse transcriptase |
|---|
| Synonyms: | n/a |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 29598.37 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WKE8 |
|---|
| Residue: | 254 |
|---|
| Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
|---|
| BDBM50478732 |
|---|
| n/a |
|---|
| Name | BDBM50478732 |
|---|
| Synonyms: | CHEMBL443403 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C34H24Br2N4O6S2 |
|---|
| Mol. Mass. | 808.516 |
|---|
| SMILES | Brc1ccc(cc1)\N=C(/OCCN1C(=O)c2ccccc2C1=O)SS\C(OCCN1C(=O)c2ccccc2C1=O)=N\c1ccc(Br)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
