| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50478918 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_491409 (CHEMBL945372) |
|---|
| IC50 | 95±n/a nM |
|---|
| Citation |  Zhang, M; Nguyen, JT; Kumada, HO; Kimura, T; Cheng, M; Hayashi, Y; Kiso, Y Locking the two ends of tetrapeptidic HTLV-I protease inhibitors inside the enzyme. Bioorg Med Chem16:6880-90 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | Protease | prt |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 13462.60 |
|---|
| Organism: | Human T-cell leukemia virus type I |
|---|
| Description: | ChEMBL_118454 |
|---|
| Residue: | 125 |
|---|
| Sequence: | PVIPLDPARRPVIKAQVDTQTSHPKTIEALLDTGADMTVLPIALFSSNTPLKNTSVLGAG
GQTQDHFKLTSLPVLIRLPFRTTPIVLTSCLVDTKNNWAIIGRDALQQCQGVLYLPEAKG
PPVIL
|
|
|
|---|
| BDBM50478918 |
|---|
| n/a |
|---|
| Name | BDBM50478918 |
|---|
| Synonyms: | CHEMBL502067 | KNI-10671 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C39H57N5O6S |
|---|
| Mol. Mass. | 723.965 |
|---|
| SMILES | CCCC(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](Cc1ccccc1)[C@H](O)C(=O)N1CSC(C)(C)[C@H]1C(=O)NCCC(C)C)C(C)(C)C)c1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
