Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Protease |
---|
Ligand | BDBM50478918 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_491409 (CHEMBL945372) |
---|
IC50 | 95±n/a nM |
---|
Citation | Zhang, M; Nguyen, JT; Kumada, HO; Kimura, T; Cheng, M; Hayashi, Y; Kiso, Y Locking the two ends of tetrapeptidic HTLV-I protease inhibitors inside the enzyme. Bioorg Med Chem16:6880-90 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protease |
---|
Name: | Protease |
Synonyms: | Protease | prt |
Type: | PROTEIN |
Mol. Mass.: | 13462.60 |
Organism: | Human T-cell leukemia virus type I |
Description: | ChEMBL_118454 |
Residue: | 125 |
Sequence: | PVIPLDPARRPVIKAQVDTQTSHPKTIEALLDTGADMTVLPIALFSSNTPLKNTSVLGAG
GQTQDHFKLTSLPVLIRLPFRTTPIVLTSCLVDTKNNWAIIGRDALQQCQGVLYLPEAKG
PPVIL
|
|
|
BDBM50478918 |
---|
n/a |
---|
Name | BDBM50478918 |
Synonyms: | CHEMBL502067 | KNI-10671 |
Type | Small organic molecule |
Emp. Form. | C39H57N5O6S |
Mol. Mass. | 723.965 |
SMILES | CCCC(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](Cc1ccccc1)[C@H](O)C(=O)N1CSC(C)(C)[C@H]1C(=O)NCCC(C)C)C(C)(C)C)c1ccccc1 |r| |
Structure |
|