| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase |
|---|
| Ligand | BDBM50479962 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_564789 (CHEMBL954255) |
|---|
| IC50 | 3.0±n/a nM |
|---|
| Citation |  Piscitelli, F; Coluccia, A; Brancale, A; La Regina, G; Sansone, A; Giordano, C; Balzarini, J; Maga, G; Zanoli, S; Samuele, A; Cirilli, R; La Torre, F; Lavecchia, A; Novellino, E; Silvestri, R Indolylarylsulfones bearing natural and unnatural amino acids. Discovery of potent inhibitors of HIV-1 non-nucleoside wild type and resistant mutant strains reverse transcriptase and coxsackie B4 virus. J Med Chem52:1922-34 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase |
|---|
| Name: | Reverse transcriptase |
|---|
| Synonyms: | n/a |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 29598.37 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WKE8 |
|---|
| Residue: | 254 |
|---|
| Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
|---|
| BDBM50479962 |
|---|
| n/a |
|---|
| Name | BDBM50479962 |
|---|
| Synonyms: | CHEMBL502566 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H22BrN3O5S2 |
|---|
| Mol. Mass. | 528.44 |
|---|
| SMILES | CC(CS(N)(=O)=O)NC(=O)c1[nH]c2ccc(Br)cc2c1S(=O)(=O)c1cc(C)cc(C)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
