| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase |
|---|
| Ligand | BDBM50480227 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_545205 (CHEMBL1018956) |
|---|
| IC50 | 300±n/a nM |
|---|
| Citation |  Spallarossa, A; Cesarini, S; Ranise, A; Schenone, S; Bruno, O; Borassi, A; La Colla, P; Pezzullo, M; Sanna, G; Collu, G; Secci, B; Loddo, R Parallel synthesis, molecular modelling and further structure-activity relationship studies of new acylthiocarbamates as potent non-nucleoside HIV-1 reverse transcriptase inhibitors. Eur J Med Chem44:2190-201 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase |
|---|
| Name: | Reverse transcriptase |
|---|
| Synonyms: | n/a |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 29598.37 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WKE8 |
|---|
| Residue: | 254 |
|---|
| Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
|---|
| BDBM50480227 |
|---|
| n/a |
|---|
| Name | BDBM50480227 |
|---|
| Synonyms: | CHEMBL520032 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H18ClN3O6S |
|---|
| Mol. Mass. | 523.945 |
|---|
| SMILES | Cc1ccc2C(=O)N(CCOC(=S)N(C(=O)c3ccc(Cl)cc3)c3ccc(cc3)[N+]([O-])=O)C(=O)c2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
