| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase protein |
|---|
| Ligand | BDBM50482297 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_640766 (CHEMBL1175707) |
|---|
| IC50 | 69±n/a nM |
|---|
| Citation |  Kertesz, DJ; Brotherton-Pleiss, C; Yang, M; Wang, Z; Lin, X; Qiu, Z; Hirschfeld, DR; Gleason, S; Mirzadegan, T; Dunten, PW; Harris, SF; Villaseņor, AG; Hang, JQ; Heilek, GM; Klumpp, K Discovery of piperidin-4-yl-aminopyrimidines as HIV-1 reverse transcriptase inhibitors. N-benzyl derivatives with broad potency against resistant mutant viruses. Bioorg Med Chem Lett20:4215-8 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase protein |
|---|
| Name: | Reverse transcriptase protein |
|---|
| Synonyms: | Reverse Transcriptase | Reverse Transcriptase (A62V) | Reverse Transcriptase (F61A) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 30203.56 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WJQ2 |
|---|
| Residue: | 259 |
|---|
| Sequence: | PISPIEPVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYEHHPDKWT
VQPIVLPEKDSWTVNDIQK
|
|
|
|---|
| BDBM50482297 |
|---|
| n/a |
|---|
| Name | BDBM50482297 |
|---|
| Synonyms: | CHEMBL1169982 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H26BrClN6O2 |
|---|
| Mol. Mass. | 569.881 |
|---|
| SMILES | Cc1cc(cc(C)c1Oc1nc(NC2CCN(Cc3ccc(cc3Cl)C(N)=O)CC2)ncc1Br)C#N |
|---|
| Structure | 
|
|---|
Search and Browse
