Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Reverse transcriptase |
---|
Ligand | BDBM50482307 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_640767 (CHEMBL1175708) |
---|
IC50 | 72±n/a nM |
---|
Citation | Kertesz, DJ; Brotherton-Pleiss, C; Yang, M; Wang, Z; Lin, X; Qiu, Z; Hirschfeld, DR; Gleason, S; Mirzadegan, T; Dunten, PW; Harris, SF; Villaseņor, AG; Hang, JQ; Heilek, GM; Klumpp, K Discovery of piperidin-4-yl-aminopyrimidines as HIV-1 reverse transcriptase inhibitors. N-benzyl derivatives with broad potency against resistant mutant viruses. Bioorg Med Chem Lett20:4215-8 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Reverse transcriptase |
---|
Name: | Reverse transcriptase |
Synonyms: | n/a |
Type: | Protein |
Mol. Mass.: | 29598.37 |
Organism: | Human immunodeficiency virus 1 |
Description: | Q9WKE8 |
Residue: | 254 |
Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
BDBM50482307 |
---|
n/a |
---|
Name | BDBM50482307 |
Synonyms: | CHEMBL1169811 |
Type | Small organic molecule |
Emp. Form. | C26H29N5O3S |
Mol. Mass. | 491.605 |
SMILES | Cc1cc(cc(C)c1Oc1ccnc(NC2CCN(Cc3ccc(cc3)S(C)(=O)=O)CC2)n1)C#N |
Structure |
|