| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prolyl hydroxylase EGLN2 |
|---|
| Ligand | BDBM50507407 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1829979 (CHEMBL4329853) |
|---|
| IC50 | 2.4±n/a nM |
|---|
| Citation |  Liu, P; Wang, L; DuBois, BG; Colandrea, VJ; Liu, R; Cai, J; Du, X; Quan, W; Morris, W; Bai, J; Bishwokarma, B; Cheng, M; Piesvaux, J; Ray, K; Alpert, C; Chiu, CS; Zielstorff, M; Metzger, JM; Yang, L; Leung, D; Alleyne, C; Vincent, SH; Pucci, V; Li, X; Crespo, A; Stickens, D; Hale, JJ; Ujjainwalla, F; Sinz, CJ Discovery of Orally Bioavailable and Liver-Targeted Hypoxia-Inducible Factor Prolyl Hydroxylase (HIF-PHD) Inhibitors for the Treatment of Anemia. ACS Med Chem Lett9:1193-1198 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prolyl hydroxylase EGLN2 |
|---|
| Name: | Prolyl hydroxylase EGLN2 |
|---|
| Synonyms: | EGLN2 | EGLN2_HUMAN | EIT6 | Egl nine homolog 2 | Estrogen-induced tag 6 | HIF prolyl hydroxylase | HIF-PH1 | HIF-prolyl hydroxylase 1 | HPH-3 | Hypoxia-inducible factor prolyl hydroxylase | PHD1 | Prolyl hydroxylase domain-containing protein 1 | Prolyl hydroxylase domain-containing protein 1 (PHD1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 43657.01 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q96KS0 |
|---|
| Residue: | 407 |
|---|
| Sequence: | MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAG
SGTPRATATSTTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRLAAQGARPEAPKRK
WAEDGGDAPSPSKRPWARQENQEAEREGGMSCSCSSGSGEASAGLMEEALPSAPERLALD
YIVPCMRYYGICVKDSFLGAALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQI
AWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRTKAMVACYPGNGLGYVRHVDN
PHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEV
KPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT
|
|
|
|---|
| BDBM50507407 |
|---|
| n/a |
|---|
| Name | BDBM50507407 |
|---|
| Synonyms: | CHEMBL4590677 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H12F3N3O6S |
|---|
| Mol. Mass. | 419.332 |
|---|
| SMILES | OC(=O)CNC(=O)c1c(O)c2COCc2n(Cc2cnc(s2)C(F)(F)F)c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
