| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Neutrophil elastase |
|---|
| Ligand | BDBM50065160 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_63976 (CHEMBL677602) |
|---|
| Ki | 95000±n/a nM |
|---|
| Citation |  Cregge, RJ; Durham, SL; Farr, RA; Gallion, SL; Hare, CM; Hoffman, RV; Janusz, MJ; Kim, HO; Koehl, JR; Mehdi, S; Metz, WA; Peet, NP; Pelton, JT; Schreuder, HA; Sunder, S; Tardif, C Inhibition of human neutrophil elastase. 4. Design, synthesis, X-ray crystallographic analysis, and structure-activity relationships for a series of P2-modified, orally active peptidyl pentafluoroethyl ketones. J Med Chem41:2461-80 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Neutrophil elastase |
|---|
| Name: | Neutrophil elastase |
|---|
| Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28532.38 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P08246 |
|---|
| Residue: | 267 |
|---|
| Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
|---|
| BDBM50065160 |
|---|
| n/a |
|---|
| Name | BDBM50065160 |
|---|
| Synonyms: | 4-(Morpholine-4-carbonyl)-N-{(R)-2-oxo-1-[(3,3,4,4,4-pentafluoro-1-isopropyl-2-oxo-butylcarbamoyl)-methyl]-piperidin-3-yl}-benzamide | CHEMBL309326 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H31F5N4O6 |
|---|
| Mol. Mass. | 590.5396 |
|---|
| SMILES | CC(C)C(NC(=O)CN1CCC[C@@H](NC(=O)c2ccc(cc2)C(=O)N2CCOCC2)C1=O)C(=O)C(F)(F)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
