| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptide deformylase |
|---|
| Ligand | BDBM50535517 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1930891 (CHEMBL4434142) |
|---|
| IC50 | 158±n/a nM |
|---|
| Citation |  Spletstoser, JT; Dreabit, J; Knox, AN; Benowitz, A; Campobasso, N; Ward, P; Cui, G; Lewandowski, T; McCloskey, L; Aubart, KM Discovery of piperazic acid peptide deformylase inhibitors with in vivo activity for respiratory tract and skin infections. Bioorg Med Chem Lett29:2410-2414 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptide deformylase |
|---|
| Name: | Peptide deformylase |
|---|
| Synonyms: | DEF_STAAM | PDF | Polypeptide deformylase | def | def1 | pdf1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 20556.80 |
|---|
| Organism: | Staphylococcus aureus |
|---|
| Description: | P68825 |
|---|
| Residue: | 183 |
|---|
| Sequence: | MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVG
LAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAG
LVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDA
VEV
|
|
|
|---|
| BDBM50535517 |
|---|
| n/a |
|---|
| Name | BDBM50535517 |
|---|
| Synonyms: | CHEMBL4474270 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H31BN4O6 |
|---|
| Mol. Mass. | 458.316 |
|---|
| SMILES | OB1OCc2c1cccc2NC(=O)[C@@H]1CCCNN1C(=O)[C@H](CC1CCCC1)CN(O)C=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
