| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Isoleucyl-tRNA synthetase |
|---|
| Ligand | BDBM50093006 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_88824 |
|---|
| IC50 | 500±n/a nM |
|---|
| Citation |  Banwell, MG; Crasto, CF; Easton, CJ; Forrest, AK; Karoli, T; March, DR; Mensah, L; Nairn, MR; O'Hanlon, PJ; Oldham, MD; Yue, W Analogues of SB-203207 as inhibitors of tRNA synthetases. Bioorg Med Chem Lett10:2263-6 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Isoleucyl-tRNA synthetase |
|---|
| Name: | Isoleucyl-tRNA synthetase |
|---|
| Synonyms: | n/a |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 5742.00 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_88824 |
|---|
| Residue: | 50 |
|---|
| Sequence: | MQTSLGNFVTTTGISSTRTPRPRRESVYFDLIKLKIFHQITQENPGSRNI
|
|
|
|---|
| BDBM50093006 |
|---|
| n/a |
|---|
| Name | BDBM50093006 |
|---|
| Synonyms: | (4aR,6S,7R,7aS)-6-((2S,3S)-2-Benzyloxycarbonylamino-3-methyl-pentanoyloxy)-7-[2-((2S,3S)-2-benzyloxycarbonylamino-3-methyl-pentanoylsulfamoyl)-acetylamino]-4-carbamoyl-2-methyl-2,4a,5,6,7,7a-hexahydro-1H-[2]pyrindine-7-carboxylic acid methyl ester | CHEMBL73465 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C42H56N6O13S |
|---|
| Mol. Mass. | 884.991 |
|---|
| SMILES | CC[C@H](C)[C@H](NC(=O)OCc1ccccc1)C(=O)NS(=O)(=O)CC(=O)N[C@]1([C@H](C[C@@H]2[C@H]1CN(C)C=C2C(N)=O)OC(=O)[C@@H](NC(=O)OCc1ccccc1)[C@@H](C)CC)C(=O)OC |c:36| |
|---|
| Structure | 
|
|---|
Search and Browse
