| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Translocator protein |
|---|
| Ligand | BDBM50541998 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1988755 (CHEMBL4622302) |
|---|
| Ki | 510±n/a nM |
|---|
| Citation |  Jung, YH; Yu, J; Wen, Z; Salmaso, V; Karcz, TP; Phung, NB; Chen, Z; Duca, S; Bennett, JM; Dudas, S; Salvemini, D; Gao, ZG; Cook, DN; Jacobson, KA Exploration of Alternative Scaffolds for P2Y J Med Chem63:9563-9589 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Translocator protein |
|---|
| Name: | Translocator protein |
|---|
| Synonyms: | BZRP | MBR | Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor | TSPO | TSPO_HUMAN |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18834.74 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30536 |
|---|
| Residue: | 169 |
|---|
| Sequence: | MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
|
|
|
|---|
| BDBM50541998 |
|---|
| n/a |
|---|
| Name | BDBM50541998 |
|---|
| Synonyms: | CHEMBL4642592 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H26F3NO3 |
|---|
| Mol. Mass. | 517.5382 |
|---|
| SMILES | CC(=O)N1CCC(CC1)c1ccc(cc1)-c1cc(cc2cc(ccc12)-c1ccc(cc1)C(F)(F)F)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
