Reaction Details |
| Report a problem with these data |
Target | Prostaglandin E2 receptor EP3 subtype |
---|
Ligand | BDBM50117694 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_158321 |
---|
Ki | 120±n/a nM |
---|
Citation | Gallant, M; Carrière, MC; Chateauneuf, A; Denis, D; Gareau, Y; Godbout, C; Greig, G; Juteau, H; Lachance, N; Lacombe, P; Lamontagne, S; Metters, KM; Rochette, C; Ruel, R; Slipetz, D; Sawyer, N; Tremblay, N; Labelle, M Structure-activity relationship of biaryl acylsulfonamide analogues on the human EP(3) prostanoid receptor. Bioorg Med Chem Lett12:2583-6 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E2 receptor EP3 subtype |
---|
Name: | Prostaglandin E2 receptor EP3 subtype |
Synonyms: | PE2R3_HUMAN | PGE receptor, EP3 subtype | PGE2-R | PTGER3 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP3 subtype | Prostaglandin E2 receptor EP3 subtype (EP3) | Prostaglandin E2 receptor EP3A subtype (EP3A) | Prostaglandin E2 receptor EP3D subtype (EP3D) | Prostanoid EP3 receptor |
Type: | Enzyme |
Mol. Mass.: | 43335.03 |
Organism: | Homo sapiens (Human) |
Description: | P43115 |
Residue: | 390 |
Sequence: | MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL
TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG
VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL
ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQI
RYHTNNYASSSTSLPCQCSSTLMWSDHLER
|
|
|
BDBM50117694 |
---|
n/a |
---|
Name | BDBM50117694 |
Synonyms: | CHEMBL83450 | Thiophene-2-sulfonic acid (3-{3'-[(E)-2-(7-chloro-quinolin-2-yl)-vinyl]-biphenyl-2-yl}-propionyl)-amide |
Type | Small organic molecule |
Emp. Form. | C30H23ClN2O3S2 |
Mol. Mass. | 559.098 |
SMILES | Clc1ccc2ccc(\C=C\c3cccc(c3)-c3ccccc3CCC(=O)NS(=O)(=O)c3cccs3)nc2c1 |
Structure |
|