| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E2 receptor EP2 subtype |
|---|
| Ligand | BDBM50117699 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_158305 |
|---|
| Ki | 2700±n/a nM |
|---|
| Citation |  Gallant, M; Carrière, MC; Chateauneuf, A; Denis, D; Gareau, Y; Godbout, C; Greig, G; Juteau, H; Lachance, N; Lacombe, P; Lamontagne, S; Metters, KM; Rochette, C; Ruel, R; Slipetz, D; Sawyer, N; Tremblay, N; Labelle, M Structure-activity relationship of biaryl acylsulfonamide analogues on the human EP(3) prostanoid receptor. Bioorg Med Chem Lett12:2583-6 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E2 receptor EP2 subtype |
|---|
| Name: | Prostaglandin E2 receptor EP2 subtype |
|---|
| Synonyms: | PE2R2_HUMAN | PGE receptor EP2 subtype | PTGER2 | Prostaglandin E2 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP4 subtype | Prostanoid EP2 Receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39775.71 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P43116 |
|---|
| Residue: | 358 |
|---|
| Sequence: | MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
|
|
|
|---|
| BDBM50117699 |
|---|
| n/a |
|---|
| Name | BDBM50117699 |
|---|
| Synonyms: | CHEMBL83518 | Thiophene-2-sulfonic acid [3-(4'-phenethylsulfanylmethyl-biphenyl-2-yl)-propionyl]-amide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H27NO3S3 |
|---|
| Mol. Mass. | 521.714 |
|---|
| SMILES | O=C(CCc1ccccc1-c1ccc(CSCCc2ccccc2)cc1)NS(=O)(=O)c1cccs1 |
|---|
| Structure | 
|
|---|
Search and Browse
