Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50156902 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_429830 (CHEMBL915411) |
---|
Ki | 250±n/a nM |
---|
Citation | Merabet, N; Dumond, J; Collinet, B; Van Baelinghem, L; Boggetto, N; Ongeri, S; Ressad, F; Reboud-Ravaux, M; Sicsic, S New constrained"molecular tongs" designed to dissociate HIV-1 protease dimer. J Med Chem47:6392-400 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50156902 |
---|
n/a |
---|
Name | BDBM50156902 |
Synonyms: | (S)-methyl 2-((S)-2-((S)-2-(4-(2-(4-((2S,3S)-1-((2S,3R)-1-amino-3-hydroxy-1-oxobutan-2-ylamino)-3-methyl-1-oxopentan-2-ylamino)-4-oxobutoxy)quinolin-7-yloxy)butanamido)-3-methylbutanamido)-4-methylpentanamido)-3-methylbutanoate | CHEMBL222213 |
Type | Small organic molecule |
Emp. Form. | C44H69N7O11 |
Mol. Mass. | 872.059 |
SMILES | CC[C@H](C)[C@H](NC(=O)CCCOc1ccc2ccc(OCCCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)OC)cc2n1)C(=O)N[C@@H]([C@@H](C)O)C(N)=O |r| |
Structure |
|