| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50156902 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_429830 (CHEMBL915411) |
|---|
| Ki | 250±n/a nM |
|---|
| Citation |  Merabet, N; Dumond, J; Collinet, B; Van Baelinghem, L; Boggetto, N; Ongeri, S; Ressad, F; Reboud-Ravaux, M; Sicsic, S New constrained"molecular tongs" designed to dissociate HIV-1 protease dimer. J Med Chem47:6392-400 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50156902 |
|---|
| n/a |
|---|
| Name | BDBM50156902 |
|---|
| Synonyms: | (S)-methyl 2-((S)-2-((S)-2-(4-(2-(4-((2S,3S)-1-((2S,3R)-1-amino-3-hydroxy-1-oxobutan-2-ylamino)-3-methyl-1-oxopentan-2-ylamino)-4-oxobutoxy)quinolin-7-yloxy)butanamido)-3-methylbutanamido)-4-methylpentanamido)-3-methylbutanoate | CHEMBL222213 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C44H69N7O11 |
|---|
| Mol. Mass. | 872.059 |
|---|
| SMILES | CC[C@H](C)[C@H](NC(=O)CCCOc1ccc2ccc(OCCCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)OC)cc2n1)C(=O)N[C@@H]([C@@H](C)O)C(N)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
