| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit beta type-5 |
|---|
| Ligand | BDBM388395 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2237808 (CHEMBL5151704) |
|---|
| IC50 | 222±n/a nM |
|---|
| Citation |  Klein, M; Busch, M; Friese-Hamim, M; Crosignani, S; Fuchss, T; Musil, D; Rohdich, F; Sanderson, MP; Seenisamy, J; Walter-Bausch, G; Zanelli, U; Hewitt, P; Esdar, C; Schadt, O Structure-Based Optimization and Discovery of M3258, a Specific Inhibitor of the Immunoproteasome Subunit LMP7 (?5i). J Med Chem64:10230-10245 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit beta type-5 |
|---|
| Name: | Proteasome subunit beta type-5 |
|---|
| Synonyms: | 20S proteasome chymotrypsin-like | 26S proteosome | LMPX | MB1 | PSB5_HUMAN | PSMB5 | Proteasome Macropain subunit MB1 | Proteasome subunit beta type-1/beta type-5 | X |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 28480.96 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 263 |
|---|
| Sequence: | MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
|
|
|
|---|
| BDBM388395 |
|---|
| n/a |
|---|
| Name | BDBM388395 |
|---|
| Synonyms: | US10294246, Compound No. 92 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H20BNO5 |
|---|
| Mol. Mass. | 353.177 |
|---|
| SMILES | COc1cccc2c(C[C@H](NC(=O)Cc3ccccc3)B(O)O)coc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
