Reaction Details |
| Report a problem with these data |
Target | Proteasome subunit beta type-8 |
---|
Ligand | BDBM50601657 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2237809 (CHEMBL5151705) |
---|
IC50 | 20±n/a nM |
---|
Citation | Klein, M; Busch, M; Friese-Hamim, M; Crosignani, S; Fuchss, T; Musil, D; Rohdich, F; Sanderson, MP; Seenisamy, J; Walter-Bausch, G; Zanelli, U; Hewitt, P; Esdar, C; Schadt, O Structure-Based Optimization and Discovery of M3258, a Specific Inhibitor of the Immunoproteasome Subunit LMP7 (?5i). J Med Chem64:10230-10245 (2021) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proteasome subunit beta type-8 |
---|
Name: | Proteasome subunit beta type-8 |
Synonyms: | 26S proteosome | LMP7 | Low molecular mass protein 7 | Macropain subunit C13 | Multicatalytic endopeptidase complex subunit C13 | PSB8_HUMAN | PSMB5i | PSMB8 | Proteasome component C13 | Proteasome subunit beta type-8 | Proteasome subunit beta-5i | RING10 | Y2 |
Type: | PROTEIN |
Mol. Mass.: | 30357.49 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1446797 |
Residue: | 276 |
Sequence: | MALLDVCGAPRGQRPESALPVAGSGRRSDPGHYSFSMRSPELALPRGMQPTEFFQSLGGD
GERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGC
AADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKG
PGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDS
YSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
|
|
|
BDBM50601657 |
---|
n/a |
---|
Name | BDBM50601657 |
Synonyms: | CHEMBL5177052 |
Type | Small organic molecule |
Emp. Form. | C17H20BNO5 |
Mol. Mass. | 329.155 |
SMILES | [H][C@@]12CC[C@@]([H])(O1)[C@H](C2)C(=O)N[C@@H](Cc1coc2ccccc12)B(O)O |r| |
Structure |
|